Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HDY5

Protein Details
Accession A0A1Y2HDY5    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-49KGCPRCRPCGLTRKRWRPNSRRPQNTRPTSWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 13.166, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MKLRAAFTSERARRAAPTKGCPRCRPCGLTRKRWRPNSRRPQNTRPTSWACPWTWRPRWTPWISSKRTPNLRPNVACSSLSFLILRLGACARDAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.43
4 0.48
5 0.55
6 0.62
7 0.69
8 0.73
9 0.74
10 0.73
11 0.73
12 0.69
13 0.67
14 0.68
15 0.68
16 0.7
17 0.75
18 0.78
19 0.81
20 0.85
21 0.88
22 0.87
23 0.9
24 0.9
25 0.9
26 0.9
27 0.89
28 0.88
29 0.88
30 0.84
31 0.77
32 0.71
33 0.67
34 0.6
35 0.54
36 0.49
37 0.39
38 0.38
39 0.41
40 0.44
41 0.45
42 0.46
43 0.48
44 0.49
45 0.58
46 0.56
47 0.57
48 0.57
49 0.6
50 0.61
51 0.64
52 0.66
53 0.66
54 0.7
55 0.7
56 0.7
57 0.69
58 0.72
59 0.68
60 0.66
61 0.63
62 0.57
63 0.51
64 0.42
65 0.39
66 0.31
67 0.3
68 0.24
69 0.18
70 0.17
71 0.18
72 0.17
73 0.12
74 0.13
75 0.12