Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HGV1

Protein Details
Accession A0A1Y2HGV1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
222-241DEIVKERKGRREGRGRVGGGBasic
NLS Segment(s)
PositionSequence
227-237ERKGRREGRGR
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MFPVRSVHHHSHHHHGHGHAGHHHASSGSTSHSNHPPAMAAASPVSKNDPSIVYKLLCIGTLGAAQYFGQECILASLERRKATASPVPGASGASGSGNSSLHIPGSATSPGSSSSLTTAGAAPGASGPNASVIFSPHSIVTCEPTEIFRISKVDFLKLMTPKALNIMEAIERDQMAAYDPANSGGAQHSMHLAMGMGVPLRAIQDAFVRSHQWAHYRTRVMDEIVKERKGRREGRGRVGGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.54
3 0.55
4 0.5
5 0.49
6 0.43
7 0.4
8 0.37
9 0.32
10 0.32
11 0.24
12 0.21
13 0.18
14 0.15
15 0.15
16 0.16
17 0.18
18 0.23
19 0.29
20 0.31
21 0.3
22 0.29
23 0.27
24 0.24
25 0.24
26 0.18
27 0.13
28 0.12
29 0.14
30 0.14
31 0.14
32 0.17
33 0.16
34 0.16
35 0.17
36 0.18
37 0.19
38 0.21
39 0.23
40 0.2
41 0.2
42 0.22
43 0.2
44 0.17
45 0.14
46 0.11
47 0.09
48 0.1
49 0.1
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.07
62 0.08
63 0.14
64 0.18
65 0.19
66 0.19
67 0.2
68 0.19
69 0.25
70 0.28
71 0.25
72 0.23
73 0.23
74 0.24
75 0.23
76 0.22
77 0.17
78 0.12
79 0.08
80 0.06
81 0.06
82 0.05
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.08
93 0.08
94 0.07
95 0.07
96 0.08
97 0.09
98 0.09
99 0.09
100 0.07
101 0.07
102 0.08
103 0.08
104 0.08
105 0.07
106 0.06
107 0.06
108 0.06
109 0.04
110 0.04
111 0.05
112 0.04
113 0.04
114 0.04
115 0.05
116 0.05
117 0.06
118 0.05
119 0.06
120 0.08
121 0.08
122 0.09
123 0.08
124 0.08
125 0.09
126 0.09
127 0.11
128 0.1
129 0.1
130 0.1
131 0.11
132 0.12
133 0.13
134 0.13
135 0.11
136 0.12
137 0.12
138 0.17
139 0.17
140 0.16
141 0.16
142 0.17
143 0.21
144 0.21
145 0.22
146 0.19
147 0.19
148 0.17
149 0.21
150 0.2
151 0.14
152 0.12
153 0.13
154 0.12
155 0.12
156 0.13
157 0.1
158 0.1
159 0.1
160 0.09
161 0.08
162 0.09
163 0.09
164 0.08
165 0.09
166 0.09
167 0.1
168 0.11
169 0.11
170 0.09
171 0.1
172 0.11
173 0.09
174 0.1
175 0.1
176 0.09
177 0.09
178 0.09
179 0.07
180 0.06
181 0.06
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.06
190 0.06
191 0.11
192 0.13
193 0.15
194 0.17
195 0.18
196 0.19
197 0.23
198 0.25
199 0.27
200 0.3
201 0.35
202 0.42
203 0.45
204 0.46
205 0.48
206 0.47
207 0.44
208 0.45
209 0.42
210 0.43
211 0.45
212 0.48
213 0.46
214 0.49
215 0.55
216 0.58
217 0.62
218 0.62
219 0.67
220 0.71
221 0.77
222 0.81