Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I1U5

Protein Details
Accession A0A1Y2I1U5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-36PCSHVLRPSCRKKRSQHSFYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MMRRLHSGARLGPPACPCSHVLRPSCRKKRSQHSFYALCNDRNNSGNDCTAAHRLGLIELAPVRCKCKCKCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.29
4 0.26
5 0.28
6 0.34
7 0.37
8 0.39
9 0.46
10 0.55
11 0.64
12 0.71
13 0.7
14 0.72
15 0.74
16 0.8
17 0.81
18 0.77
19 0.75
20 0.73
21 0.71
22 0.64
23 0.63
24 0.55
25 0.47
26 0.42
27 0.35
28 0.29
29 0.27
30 0.28
31 0.23
32 0.22
33 0.2
34 0.19
35 0.19
36 0.2
37 0.2
38 0.18
39 0.15
40 0.13
41 0.13
42 0.12
43 0.12
44 0.09
45 0.08
46 0.11
47 0.13
48 0.17
49 0.18
50 0.23
51 0.27
52 0.34