Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HSZ9

Protein Details
Accession A0A1Y2HSZ9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRPMYCRIAHRARKRNHAPSFPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036010  2Fe-2S_ferredoxin-like_sf  
Gene Ontology GO:0051536  F:iron-sulfur cluster binding  
Amino Acid Sequences MRPMYCRIAHRARKRNHAPSFPADCGFVAKCDLCGVCVSDGQVGWVGWWDSRRRSTWRWWQRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.82
4 0.79
5 0.74
6 0.72
7 0.71
8 0.62
9 0.53
10 0.43
11 0.35
12 0.3
13 0.25
14 0.17
15 0.12
16 0.1
17 0.09
18 0.1
19 0.09
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.08
31 0.07
32 0.08
33 0.08
34 0.09
35 0.13
36 0.16
37 0.21
38 0.26
39 0.31
40 0.36
41 0.41
42 0.5
43 0.58