Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HYS8

Protein Details
Accession A0A1Y2HYS8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-28ADCPLQNQTSKRRRRCGQREINTYGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MRADCPLQNQTSKRRRRCGQREINTYGLMRKTAAGVKAAETSRRSPRVETLRETRQRQAEGRGKMENVESVKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.81
4 0.85
5 0.86
6 0.87
7 0.87
8 0.85
9 0.81
10 0.75
11 0.66
12 0.56
13 0.48
14 0.38
15 0.28
16 0.2
17 0.15
18 0.13
19 0.14
20 0.14
21 0.13
22 0.12
23 0.12
24 0.16
25 0.16
26 0.18
27 0.18
28 0.21
29 0.26
30 0.31
31 0.31
32 0.29
33 0.37
34 0.43
35 0.45
36 0.46
37 0.47
38 0.52
39 0.59
40 0.62
41 0.6
42 0.57
43 0.57
44 0.54
45 0.57
46 0.55
47 0.53
48 0.53
49 0.51
50 0.46
51 0.43
52 0.41
53 0.37