Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I557

Protein Details
Accession A0A1Y2I557    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-34VTPPPWIIHRHRHRHPHPQRHRHAHPSSRLRPBasic
59-85GRNPDPRKPNRMQRPTPQHQHRRCVIAHydrophilic
NLS Segment(s)
PositionSequence
12-31RHRHRHPHPQRHRHAHPSSR
Subcellular Location(s) mito 13, nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MQVTPPPWIIHRHRHRHPHPQRHRHAHPSSRLRPRLDGQCPRVRRQTHQTQPATMGSAGRNPDPRKPNRMQRPTPQHQHRRCVIAGAGAFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.83
4 0.87
5 0.87
6 0.88
7 0.89
8 0.9
9 0.89
10 0.89
11 0.88
12 0.86
13 0.82
14 0.81
15 0.8
16 0.79
17 0.79
18 0.77
19 0.69
20 0.65
21 0.62
22 0.61
23 0.6
24 0.59
25 0.55
26 0.58
27 0.59
28 0.59
29 0.61
30 0.54
31 0.5
32 0.5
33 0.54
34 0.54
35 0.6
36 0.58
37 0.51
38 0.51
39 0.47
40 0.4
41 0.3
42 0.23
43 0.14
44 0.16
45 0.16
46 0.16
47 0.23
48 0.23
49 0.3
50 0.38
51 0.43
52 0.48
53 0.55
54 0.63
55 0.68
56 0.76
57 0.76
58 0.77
59 0.83
60 0.84
61 0.86
62 0.87
63 0.86
64 0.84
65 0.85
66 0.8
67 0.75
68 0.66
69 0.6
70 0.5
71 0.45