Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HRR5

Protein Details
Accession A0A1Y2HRR5    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-95VIECRACQGKPRCRKCRSGSNGNRRLVNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 8, cyto 3, nucl 1, plas 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MRWDGWAFHWRGWKRAGRLVGSTLSACANGYRVGTESDIGRRILKCVNWWSNSAVGNVDAVFGAVVTVIECRACQGKPRCRKCRSGSNGNRRLVNRESWTQSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.53
4 0.46
5 0.47
6 0.46
7 0.4
8 0.35
9 0.3
10 0.24
11 0.18
12 0.15
13 0.13
14 0.1
15 0.09
16 0.08
17 0.08
18 0.08
19 0.08
20 0.1
21 0.1
22 0.11
23 0.11
24 0.12
25 0.14
26 0.14
27 0.16
28 0.15
29 0.16
30 0.18
31 0.18
32 0.19
33 0.25
34 0.3
35 0.29
36 0.31
37 0.3
38 0.3
39 0.3
40 0.26
41 0.19
42 0.13
43 0.12
44 0.1
45 0.09
46 0.05
47 0.04
48 0.04
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.03
57 0.03
58 0.05
59 0.08
60 0.08
61 0.17
62 0.27
63 0.37
64 0.48
65 0.59
66 0.68
67 0.71
68 0.81
69 0.8
70 0.81
71 0.8
72 0.81
73 0.81
74 0.82
75 0.85
76 0.8
77 0.79
78 0.7
79 0.67
80 0.6
81 0.57
82 0.51
83 0.5