Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HJ43

Protein Details
Accession A0A1Y2HJ43    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-96STIDPCTKRHSRRPYSSSPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, extr 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018790  DUF2358  
Pfam View protein in Pfam  
PF10184  DUF2358  
Amino Acid Sequences MIATKTAALSTARHCRRLPVQLLGLPTAAPAQIALWSSCRITAAAGSPCLHTIALETATHHFFSAGRAASLPPQPLSTIDPCTKRHSRRPYSSSPSEQEQQDQERNRHLNMGRAVHVLRNDLDHFCASGLTTTDIYSPDMRFYDPHSRLHLTSLRQYLLASKALRVLLHLYYMNPQLSLTRLVQLRHPEVQDTNLLTGPDDDPLAPEPTGQGGSSTPLLPRDVRDDEDGALRVTFLLTGLPRHRYLVRLLTPMQPLSDADLDQIEGVAMYTFNREGKVHAHWIERLIPRPNLLRYLGGASQWWRGGPKGPGSVDEWRAGWCCEEVKVPASGPEWLKRHHRQGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.53
4 0.59
5 0.57
6 0.54
7 0.55
8 0.53
9 0.55
10 0.49
11 0.42
12 0.32
13 0.26
14 0.19
15 0.13
16 0.1
17 0.07
18 0.06
19 0.08
20 0.1
21 0.11
22 0.12
23 0.14
24 0.14
25 0.15
26 0.15
27 0.13
28 0.12
29 0.14
30 0.17
31 0.19
32 0.22
33 0.22
34 0.22
35 0.22
36 0.23
37 0.2
38 0.14
39 0.12
40 0.12
41 0.13
42 0.13
43 0.14
44 0.16
45 0.18
46 0.19
47 0.17
48 0.14
49 0.12
50 0.14
51 0.18
52 0.16
53 0.14
54 0.15
55 0.15
56 0.2
57 0.23
58 0.23
59 0.18
60 0.18
61 0.18
62 0.19
63 0.23
64 0.21
65 0.24
66 0.27
67 0.31
68 0.33
69 0.41
70 0.48
71 0.51
72 0.58
73 0.64
74 0.68
75 0.73
76 0.78
77 0.8
78 0.8
79 0.8
80 0.77
81 0.69
82 0.64
83 0.59
84 0.52
85 0.46
86 0.42
87 0.4
88 0.41
89 0.42
90 0.4
91 0.43
92 0.45
93 0.41
94 0.44
95 0.39
96 0.38
97 0.38
98 0.39
99 0.32
100 0.32
101 0.32
102 0.27
103 0.27
104 0.22
105 0.17
106 0.17
107 0.17
108 0.15
109 0.16
110 0.14
111 0.13
112 0.12
113 0.11
114 0.09
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.09
121 0.09
122 0.11
123 0.12
124 0.12
125 0.12
126 0.12
127 0.12
128 0.12
129 0.16
130 0.25
131 0.26
132 0.28
133 0.31
134 0.32
135 0.32
136 0.36
137 0.35
138 0.27
139 0.3
140 0.3
141 0.26
142 0.24
143 0.24
144 0.21
145 0.19
146 0.21
147 0.16
148 0.14
149 0.16
150 0.16
151 0.16
152 0.14
153 0.14
154 0.1
155 0.11
156 0.11
157 0.09
158 0.11
159 0.13
160 0.12
161 0.1
162 0.1
163 0.09
164 0.1
165 0.12
166 0.1
167 0.12
168 0.14
169 0.15
170 0.18
171 0.22
172 0.24
173 0.24
174 0.24
175 0.22
176 0.2
177 0.22
178 0.21
179 0.17
180 0.15
181 0.13
182 0.13
183 0.11
184 0.12
185 0.11
186 0.09
187 0.08
188 0.07
189 0.07
190 0.08
191 0.1
192 0.09
193 0.09
194 0.08
195 0.09
196 0.1
197 0.09
198 0.08
199 0.06
200 0.08
201 0.09
202 0.09
203 0.09
204 0.1
205 0.12
206 0.12
207 0.13
208 0.17
209 0.18
210 0.2
211 0.21
212 0.21
213 0.2
214 0.22
215 0.21
216 0.16
217 0.13
218 0.11
219 0.09
220 0.08
221 0.07
222 0.05
223 0.06
224 0.06
225 0.1
226 0.13
227 0.17
228 0.18
229 0.2
230 0.21
231 0.22
232 0.25
233 0.29
234 0.3
235 0.31
236 0.32
237 0.35
238 0.36
239 0.35
240 0.31
241 0.24
242 0.2
243 0.2
244 0.19
245 0.14
246 0.12
247 0.11
248 0.11
249 0.1
250 0.1
251 0.06
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.06
258 0.07
259 0.08
260 0.1
261 0.1
262 0.12
263 0.16
264 0.2
265 0.26
266 0.29
267 0.31
268 0.31
269 0.33
270 0.39
271 0.4
272 0.41
273 0.4
274 0.37
275 0.38
276 0.42
277 0.42
278 0.38
279 0.36
280 0.32
281 0.28
282 0.31
283 0.28
284 0.23
285 0.23
286 0.21
287 0.23
288 0.22
289 0.22
290 0.19
291 0.19
292 0.24
293 0.27
294 0.31
295 0.34
296 0.34
297 0.35
298 0.38
299 0.44
300 0.42
301 0.39
302 0.33
303 0.28
304 0.29
305 0.28
306 0.24
307 0.19
308 0.17
309 0.17
310 0.2
311 0.2
312 0.2
313 0.22
314 0.21
315 0.23
316 0.23
317 0.27
318 0.28
319 0.34
320 0.35
321 0.39
322 0.48
323 0.53
324 0.63