FuNGI

A0A1Y2HVK4

Protein Details

Accession

A0A1Y2HVK4

Localization Confidence

Low

Confidence Score

5.3

NoLS Segment(s)

Position	Sequence	Protein Nature
175-195	DGEPSKPKTPWQRRARACAKS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 15, extr 4, E.R. 3, cyto 2, nucl 1, mito 1, vacu 1, mito_nucl 1, cyto_pero 1

Family & Domain DBs

InterPro	View protein in InterPro IPR004013 PHP_dom IPR003141 Pol/His_phosphatase_N IPR016195 Pol/histidinol_Pase-like
Gene Ontology	GO:0016020 C:membrane GO:0003824 F:catalytic activity
Pfam	View protein in Pfam PF02811 PHP

Amino Acid Sequences

MSSPPPSDPSPLVGPSVAPTPANLSSPEPELPAATTLAATLGVATATRLPPSPAPSHSPLVIPRSSVSSAPAHHRLTVLTDSASVSSFHLASGSDLQQQQQQAPLSSSRSARSQLAATTGAGAVAASSTSVASVSMRSRAPIAEDADFKPSLHPSSSHLHLSRTGDSLSVPASSDGEPSKPKTPWQRRARACAKSLCKSYLSAVLFLTFFISFSLLIYYKVNEEAVLYSEFKPTWQPLDPRSMGLVPFNPQFPMQSNANSTILVADLHAHTTVSDGRLSPKELLRSAIAQGFNVIAVTDHNTVEGGRRAAALAANDPEFKGKILVLPGVEYTCCRIHMNLIGINETIAPKAAFPTDEDIKQAIRRTHELGGIAIVNHIPWSLTQQTGYETTRIQNHPTRQQLVEWGIDGIEVVNGDILDYVSVQFSAQPNSKVPLRRNSTDAPAPAAPDTPAGDAKVADLILITGTDTHFPGSIYSWNLIDIGPANSSTPADPSLPVAGISAATVLDALRARRNSFLFDPKGTIYSSPPLPSNPRYTAVLPLKMVGSYLQSFYTYRRGMFSFVRGFCHDESVETQTGAIAWAVAWVFIVVTMWAVLRFVGRWIVQRVKDYRFAGRRGGWLRKGRVLEV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.22
3	0.24
4	0.2
5	0.16
6	0.15
7	0.18
8	0.2
9	0.21
10	0.21
11	0.21
12	0.22
13	0.26
14	0.26
15	0.23
16	0.21
17	0.21
18	0.2
19	0.18
20	0.16
21	0.13
22	0.11
23	0.1
24	0.09
25	0.08
26	0.07
27	0.05
28	0.05
29	0.05
30	0.05
31	0.05
32	0.09
33	0.1
34	0.12
35	0.13
36	0.16
37	0.19
38	0.25
39	0.29
40	0.29
41	0.35
42	0.39
43	0.42
44	0.4
45	0.4
46	0.39
47	0.39
48	0.36
49	0.31
50	0.27
51	0.29
52	0.29
53	0.26
54	0.25
55	0.23
56	0.25
57	0.31
58	0.38
59	0.34
60	0.34
61	0.34
62	0.31
63	0.32
64	0.31
65	0.25
66	0.18
67	0.18
68	0.17
69	0.17
70	0.17
71	0.13
72	0.11
73	0.12
74	0.11
75	0.1
76	0.1
77	0.09
78	0.11
79	0.14
80	0.15
81	0.19
82	0.2
83	0.21
84	0.24
85	0.25
86	0.24
87	0.25
88	0.25
89	0.21
90	0.23
91	0.25
92	0.25
93	0.28
94	0.29
95	0.26
96	0.27
97	0.29
98	0.28
99	0.28
100	0.26
101	0.23
102	0.24
103	0.23
104	0.2
105	0.18
106	0.16
107	0.13
108	0.11
109	0.1
110	0.06
111	0.05
112	0.04
113	0.03
114	0.03
115	0.03
116	0.03
117	0.04
118	0.04
119	0.04
120	0.07
121	0.09
122	0.13
123	0.13
124	0.14
125	0.15
126	0.15
127	0.18
128	0.2
129	0.22
130	0.21
131	0.24
132	0.25
133	0.28
134	0.28
135	0.24
136	0.22
137	0.21
138	0.2
139	0.18
140	0.18
141	0.18
142	0.23
143	0.26
144	0.3
145	0.29
146	0.29
147	0.32
148	0.34
149	0.33
150	0.29
151	0.26
152	0.2
153	0.19
154	0.18
155	0.14
156	0.11
157	0.09
158	0.08
159	0.09
160	0.09
161	0.11
162	0.12
163	0.14
164	0.16
165	0.2
166	0.25
167	0.24
168	0.3
169	0.39
170	0.49
171	0.57
172	0.64
173	0.71
174	0.71
175	0.8
176	0.83
177	0.78
178	0.73
179	0.72
180	0.69
181	0.65
182	0.63
183	0.55
184	0.48
185	0.42
186	0.38
187	0.37
188	0.3
189	0.25
190	0.21
191	0.19
192	0.18
193	0.17
194	0.16
195	0.08
196	0.07
197	0.06
198	0.07
199	0.06
200	0.06
201	0.08
202	0.07
203	0.08
204	0.09
205	0.09
206	0.1
207	0.1
208	0.1
209	0.08
210	0.08
211	0.08
212	0.09
213	0.1
214	0.12
215	0.12
216	0.14
217	0.13
218	0.13
219	0.15
220	0.14
221	0.16
222	0.19
223	0.21
224	0.22
225	0.31
226	0.31
227	0.29
228	0.3
229	0.27
230	0.23
231	0.21
232	0.2
233	0.14
234	0.15
235	0.15
236	0.14
237	0.13
238	0.13
239	0.14
240	0.17
241	0.15
242	0.16
243	0.18
244	0.2
245	0.2
246	0.19
247	0.17
248	0.13
249	0.11
250	0.09
251	0.07
252	0.06
253	0.05
254	0.06
255	0.06
256	0.06
257	0.05
258	0.06
259	0.07
260	0.07
261	0.08
262	0.08
263	0.11
264	0.12
265	0.14
266	0.16
267	0.17
268	0.19
269	0.19
270	0.2
271	0.18
272	0.18
273	0.17
274	0.19
275	0.17
276	0.13
277	0.13
278	0.11
279	0.1
280	0.09
281	0.07
282	0.03
283	0.04
284	0.07
285	0.07
286	0.07
287	0.07
288	0.08
289	0.08
290	0.1
291	0.11
292	0.09
293	0.08
294	0.08
295	0.08
296	0.08
297	0.09
298	0.08
299	0.07
300	0.08
301	0.08
302	0.08
303	0.08
304	0.09
305	0.08
306	0.08
307	0.07
308	0.06
309	0.07
310	0.07
311	0.09
312	0.08
313	0.08
314	0.08
315	0.08
316	0.08
317	0.07
318	0.09
319	0.08
320	0.1
321	0.1
322	0.1
323	0.11
324	0.14
325	0.16
326	0.16
327	0.16
328	0.15
329	0.15
330	0.15
331	0.14
332	0.11
333	0.08
334	0.06
335	0.06
336	0.05
337	0.06
338	0.06
339	0.06
340	0.07
341	0.11
342	0.13
343	0.13
344	0.15
345	0.15
346	0.15
347	0.18
348	0.21
349	0.19
350	0.2
351	0.22
352	0.24
353	0.25
354	0.26
355	0.24
356	0.2
357	0.18
358	0.15
359	0.13
360	0.1
361	0.07
362	0.06
363	0.05
364	0.05
365	0.04
366	0.04
367	0.08
368	0.09
369	0.1
370	0.1
371	0.11
372	0.13
373	0.16
374	0.17
375	0.14
376	0.13
377	0.15
378	0.22
379	0.23
380	0.26
381	0.29
382	0.34
383	0.4
384	0.45
385	0.46
386	0.4
387	0.39
388	0.39
389	0.35
390	0.3
391	0.23
392	0.17
393	0.14
394	0.13
395	0.12
396	0.07
397	0.05
398	0.04
399	0.03
400	0.03
401	0.03
402	0.03
403	0.04
404	0.04
405	0.03
406	0.04
407	0.04
408	0.04
409	0.04
410	0.04
411	0.07
412	0.08
413	0.12
414	0.15
415	0.16
416	0.18
417	0.21
418	0.26
419	0.29
420	0.33
421	0.39
422	0.43
423	0.43
424	0.47
425	0.47
426	0.48
427	0.47
428	0.42
429	0.37
430	0.31
431	0.3
432	0.25
433	0.23
434	0.17
435	0.14
436	0.14
437	0.12
438	0.12
439	0.11
440	0.11
441	0.1
442	0.1
443	0.1
444	0.09
445	0.07
446	0.06
447	0.06
448	0.05
449	0.05
450	0.05
451	0.04
452	0.05
453	0.06
454	0.06
455	0.07
456	0.07
457	0.07
458	0.08
459	0.09
460	0.12
461	0.13
462	0.14
463	0.13
464	0.13
465	0.14
466	0.13
467	0.12
468	0.1
469	0.1
470	0.09
471	0.09
472	0.1
473	0.1
474	0.11
475	0.1
476	0.1
477	0.11
478	0.11
479	0.11
480	0.12
481	0.13
482	0.13
483	0.13
484	0.11
485	0.1
486	0.09
487	0.08
488	0.07
489	0.05
490	0.04
491	0.04
492	0.04
493	0.06
494	0.08
495	0.1
496	0.16
497	0.19
498	0.21
499	0.26
500	0.27
501	0.3
502	0.34
503	0.41
504	0.39
505	0.39
506	0.41
507	0.37
508	0.37
509	0.33
510	0.29
511	0.23
512	0.23
513	0.24
514	0.23
515	0.24
516	0.26
517	0.32
518	0.35
519	0.39
520	0.38
521	0.38
522	0.4
523	0.4
524	0.45
525	0.45
526	0.44
527	0.37
528	0.35
529	0.32
530	0.28
531	0.27
532	0.18
533	0.16
534	0.14
535	0.15
536	0.14
537	0.15
538	0.16
539	0.19
540	0.26
541	0.24
542	0.23
543	0.26
544	0.26
545	0.29
546	0.31
547	0.36
548	0.36
549	0.36
550	0.39
551	0.38
552	0.41
553	0.38
554	0.4
555	0.32
556	0.26
557	0.28
558	0.29
559	0.28
560	0.24
561	0.23
562	0.18
563	0.18
564	0.16
565	0.12
566	0.06
567	0.05
568	0.07
569	0.07
570	0.06
571	0.06
572	0.06
573	0.06
574	0.05
575	0.06
576	0.04
577	0.04
578	0.05
579	0.05
580	0.06
581	0.06
582	0.06
583	0.07
584	0.08
585	0.09
586	0.14
587	0.15
588	0.21
589	0.28
590	0.36
591	0.39
592	0.47
593	0.51
594	0.52
595	0.58
596	0.56
597	0.59
598	0.58
599	0.58
600	0.57
601	0.55
602	0.59
603	0.59
604	0.65
605	0.64
606	0.66
607	0.68
608	0.68

A0A1Y2HVK4

3D AlphaFold-predicted Structure Viewer