Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HUL7

Protein Details
Accession A0A1Y2HUL7    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-36NNGRNKQNRGHVKPVRCSNCRRCCPKDKAIKRFIIRHydrophilic
77-99IVRVRSREGRRNRAPPQRFRFKDBasic
NLS Segment(s)
PositionSequence
81-111RSREGRRNRAPPQRFRFKDGKKVNPDAEKKA
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences NNGRNKQNRGHVKPVRCSNCRRCCPKDKAIKRFIIRPMIESAAMRDMEEACVYEKLVVPKLYVKIHYCISCAIHAHIVRVRSREGRRNRAPPQRFRFKDGKKVNPDAEKKAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.75
4 0.78
5 0.78
6 0.8
7 0.81
8 0.8
9 0.78
10 0.8
11 0.82
12 0.82
13 0.82
14 0.82
15 0.83
16 0.82
17 0.82
18 0.76
19 0.74
20 0.7
21 0.68
22 0.58
23 0.5
24 0.44
25 0.37
26 0.35
27 0.28
28 0.23
29 0.17
30 0.17
31 0.14
32 0.11
33 0.1
34 0.1
35 0.1
36 0.09
37 0.07
38 0.07
39 0.07
40 0.07
41 0.09
42 0.1
43 0.12
44 0.12
45 0.12
46 0.14
47 0.18
48 0.18
49 0.19
50 0.2
51 0.2
52 0.22
53 0.23
54 0.2
55 0.19
56 0.19
57 0.18
58 0.17
59 0.16
60 0.17
61 0.17
62 0.19
63 0.2
64 0.21
65 0.22
66 0.23
67 0.26
68 0.29
69 0.35
70 0.42
71 0.49
72 0.57
73 0.63
74 0.7
75 0.77
76 0.79
77 0.82
78 0.83
79 0.83
80 0.84
81 0.79
82 0.76
83 0.77
84 0.74
85 0.76
86 0.75
87 0.76
88 0.73
89 0.78
90 0.79
91 0.78
92 0.77
93 0.73