Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HUJ9

Protein Details
Accession A0A1Y2HUJ9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-49AALNKTPIIKKRTKRFARHQSDRYVKVGPSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
11-54IKKRTKRFARHQSDRYVKVGPSWRKPKGIDNRVRRRFKGQIRMP
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAALNKTPIIKKRTKRFARHQSDRYVKVGPSWRKPKGIDNRVRRRFKGQIRMPKIGYGSNKITRHMLPNGFKKFLVRNPKDLEVLIMHNKTYAAEVAHNVSAQKRAAIVERARQLQIVLTNGHARLRTEEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.81
4 0.85
5 0.88
6 0.9
7 0.91
8 0.87
9 0.86
10 0.85
11 0.79
12 0.71
13 0.63
14 0.52
15 0.48
16 0.51
17 0.48
18 0.49
19 0.55
20 0.56
21 0.58
22 0.6
23 0.63
24 0.64
25 0.67
26 0.67
27 0.69
28 0.76
29 0.8
30 0.84
31 0.77
32 0.73
33 0.72
34 0.71
35 0.7
36 0.68
37 0.69
38 0.7
39 0.72
40 0.65
41 0.58
42 0.51
43 0.44
44 0.38
45 0.32
46 0.3
47 0.32
48 0.33
49 0.31
50 0.32
51 0.29
52 0.31
53 0.3
54 0.3
55 0.28
56 0.36
57 0.38
58 0.37
59 0.36
60 0.34
61 0.34
62 0.36
63 0.41
64 0.35
65 0.38
66 0.41
67 0.44
68 0.43
69 0.39
70 0.34
71 0.24
72 0.25
73 0.23
74 0.2
75 0.17
76 0.16
77 0.16
78 0.15
79 0.14
80 0.12
81 0.08
82 0.09
83 0.1
84 0.12
85 0.13
86 0.13
87 0.13
88 0.13
89 0.15
90 0.14
91 0.14
92 0.12
93 0.13
94 0.16
95 0.23
96 0.25
97 0.3
98 0.35
99 0.38
100 0.37
101 0.36
102 0.33
103 0.29
104 0.29
105 0.24
106 0.19
107 0.19
108 0.22
109 0.23
110 0.26
111 0.24
112 0.22
113 0.25