Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HX57

Protein Details
Accession A0A1Y2HX57   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-29RYHASRCRASPRIRTAKKKQVKVCNVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLRYHASRCRASPRIRTAKKKQVKVCNVITKHGMNLQSTPYPDLLHIPSTHPNPTQPPSIPFAPAARLRSSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.81
4 0.81
5 0.84
6 0.85
7 0.85
8 0.83
9 0.82
10 0.81
11 0.78
12 0.77
13 0.75
14 0.68
15 0.61
16 0.56
17 0.45
18 0.38
19 0.35
20 0.28
21 0.19
22 0.19
23 0.18
24 0.17
25 0.17
26 0.17
27 0.14
28 0.12
29 0.12
30 0.13
31 0.13
32 0.13
33 0.13
34 0.15
35 0.19
36 0.22
37 0.25
38 0.23
39 0.25
40 0.28
41 0.31
42 0.34
43 0.31
44 0.32
45 0.34
46 0.34
47 0.33
48 0.3
49 0.28
50 0.29
51 0.32
52 0.32