Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2H692

Protein Details
Accession A0A1Y2H692    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-85SERFRTRTVLPTPKRPRRSRRLSIGSNHydrophilic
NLS Segment(s)
PositionSequence
71-79PKRPRRSRR
Subcellular Location(s) extr 12, plas 7, mito 5, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MGSFSCCHCRLVCMFIRLVCYVTLQISAGADTPIAPMHSSKSKTDAAVNQQNAQPKLGSERFRTRTVLPTPKRPRRSRRLSIGSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.33
4 0.3
5 0.29
6 0.22
7 0.17
8 0.15
9 0.13
10 0.12
11 0.09
12 0.09
13 0.08
14 0.08
15 0.07
16 0.06
17 0.06
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.08
25 0.14
26 0.16
27 0.16
28 0.2
29 0.21
30 0.21
31 0.24
32 0.25
33 0.27
34 0.32
35 0.33
36 0.31
37 0.32
38 0.36
39 0.34
40 0.32
41 0.24
42 0.17
43 0.23
44 0.27
45 0.29
46 0.3
47 0.39
48 0.42
49 0.45
50 0.48
51 0.43
52 0.45
53 0.5
54 0.54
55 0.5
56 0.57
57 0.65
58 0.73
59 0.81
60 0.83
61 0.84
62 0.85
63 0.9
64 0.89
65 0.89