Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HEG7

Protein Details
Accession A0A1Y2HEG7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-49RARARPCLWLRSPRRPRAVKPRAKQTRVTKQQQQSKPSHydrophilic
NLS Segment(s)
PositionSequence
23-36SPRRPRAVKPRAKQ
62-78RNLRLRGKKTWIPRRRP
Subcellular Location(s) plas 12, mito 10, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRSFTATTSSSRARARPCLWLRSPRRPRAVKPRAKQTRVTKQQQQSKPSLQLHLPTGSSRLRNLRLRGKKTWIPRRRPNGSSTMRSITRPWDIRQTGRQPGQWRRRTGPQPARQVPMQVRRRCLGPRGPRMPLVGARIIRRSGRRTMRIMDKLAQGQPMGRRACSSSSISNSSRDLMGQVCGQGVGWVHHWRCSVLFFSILLLHVFVFRLCVPPVLSIGWVDSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.53
4 0.55
5 0.59
6 0.61
7 0.67
8 0.69
9 0.72
10 0.8
11 0.78
12 0.82
13 0.8
14 0.83
15 0.83
16 0.86
17 0.85
18 0.83
19 0.85
20 0.86
21 0.83
22 0.83
23 0.82
24 0.82
25 0.82
26 0.82
27 0.8
28 0.79
29 0.85
30 0.83
31 0.79
32 0.75
33 0.71
34 0.71
35 0.64
36 0.59
37 0.5
38 0.47
39 0.43
40 0.38
41 0.33
42 0.24
43 0.25
44 0.25
45 0.25
46 0.25
47 0.28
48 0.32
49 0.38
50 0.44
51 0.5
52 0.56
53 0.61
54 0.63
55 0.64
56 0.63
57 0.67
58 0.72
59 0.71
60 0.71
61 0.75
62 0.79
63 0.79
64 0.76
65 0.7
66 0.68
67 0.65
68 0.59
69 0.54
70 0.49
71 0.43
72 0.41
73 0.38
74 0.32
75 0.33
76 0.31
77 0.29
78 0.33
79 0.34
80 0.36
81 0.42
82 0.44
83 0.44
84 0.44
85 0.46
86 0.44
87 0.52
88 0.59
89 0.58
90 0.57
91 0.54
92 0.6
93 0.61
94 0.64
95 0.64
96 0.62
97 0.65
98 0.64
99 0.63
100 0.54
101 0.54
102 0.48
103 0.48
104 0.49
105 0.43
106 0.42
107 0.4
108 0.43
109 0.41
110 0.4
111 0.39
112 0.4
113 0.46
114 0.48
115 0.49
116 0.48
117 0.48
118 0.45
119 0.38
120 0.32
121 0.26
122 0.24
123 0.24
124 0.24
125 0.25
126 0.26
127 0.28
128 0.29
129 0.34
130 0.4
131 0.43
132 0.45
133 0.49
134 0.54
135 0.54
136 0.54
137 0.49
138 0.44
139 0.43
140 0.4
141 0.36
142 0.26
143 0.25
144 0.25
145 0.28
146 0.26
147 0.22
148 0.22
149 0.23
150 0.25
151 0.26
152 0.26
153 0.24
154 0.27
155 0.32
156 0.33
157 0.33
158 0.32
159 0.3
160 0.26
161 0.21
162 0.18
163 0.13
164 0.14
165 0.12
166 0.11
167 0.1
168 0.1
169 0.09
170 0.09
171 0.09
172 0.09
173 0.12
174 0.19
175 0.19
176 0.23
177 0.24
178 0.24
179 0.24
180 0.25
181 0.24
182 0.18
183 0.19
184 0.15
185 0.16
186 0.16
187 0.16
188 0.14
189 0.12
190 0.1
191 0.09
192 0.1
193 0.08
194 0.1
195 0.09
196 0.12
197 0.13
198 0.15
199 0.16
200 0.17
201 0.19
202 0.17
203 0.18
204 0.15
205 0.15