Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HD67

Protein Details
Accession A0A1Y2HD67    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
173-197SKTGKSSAGKKDKSKSKSKDDCTIMHydrophilic
NLS Segment(s)
PositionSequence
181-188GKKDKSKS
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MELPHIGKHCSVKTCNLNDFLPYTCPGCKAVYCHDHWRHADHECSNPPSDRTVPSCPLCNQVVPIRQGDDPNLRVDQHIAAGCPVTASNASRAPPSKKCCYRACAAKTMVPVQCKACHLTFCLKHRLERDHECNPPPPPTATQEFVGKVSAKFASLSLSGNANGAACSGSLSSKTGKSSAGKKDKSKSKSKDDCTIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.54
4 0.49
5 0.44
6 0.43
7 0.36
8 0.3
9 0.25
10 0.22
11 0.2
12 0.21
13 0.21
14 0.21
15 0.21
16 0.22
17 0.29
18 0.33
19 0.37
20 0.46
21 0.49
22 0.54
23 0.54
24 0.54
25 0.49
26 0.47
27 0.47
28 0.4
29 0.42
30 0.4
31 0.41
32 0.4
33 0.39
34 0.36
35 0.34
36 0.34
37 0.3
38 0.3
39 0.32
40 0.35
41 0.35
42 0.38
43 0.35
44 0.37
45 0.35
46 0.3
47 0.27
48 0.27
49 0.3
50 0.28
51 0.27
52 0.25
53 0.25
54 0.25
55 0.26
56 0.26
57 0.22
58 0.23
59 0.23
60 0.21
61 0.2
62 0.2
63 0.16
64 0.14
65 0.13
66 0.1
67 0.09
68 0.09
69 0.09
70 0.08
71 0.07
72 0.05
73 0.05
74 0.06
75 0.08
76 0.1
77 0.11
78 0.13
79 0.16
80 0.2
81 0.26
82 0.31
83 0.38
84 0.42
85 0.48
86 0.5
87 0.5
88 0.51
89 0.53
90 0.51
91 0.49
92 0.44
93 0.41
94 0.39
95 0.4
96 0.37
97 0.3
98 0.28
99 0.23
100 0.24
101 0.23
102 0.24
103 0.2
104 0.18
105 0.19
106 0.26
107 0.29
108 0.3
109 0.39
110 0.37
111 0.39
112 0.43
113 0.47
114 0.46
115 0.49
116 0.52
117 0.49
118 0.54
119 0.52
120 0.52
121 0.49
122 0.46
123 0.39
124 0.35
125 0.31
126 0.3
127 0.32
128 0.3
129 0.29
130 0.29
131 0.28
132 0.26
133 0.25
134 0.22
135 0.18
136 0.18
137 0.16
138 0.14
139 0.13
140 0.12
141 0.13
142 0.12
143 0.14
144 0.12
145 0.14
146 0.13
147 0.13
148 0.13
149 0.1
150 0.09
151 0.08
152 0.07
153 0.05
154 0.06
155 0.06
156 0.07
157 0.08
158 0.1
159 0.13
160 0.15
161 0.18
162 0.18
163 0.22
164 0.27
165 0.34
166 0.43
167 0.51
168 0.56
169 0.62
170 0.7
171 0.76
172 0.78
173 0.8
174 0.78
175 0.79
176 0.82
177 0.81