Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HKG7

Protein Details
Accession A0A1Y2HKG7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-43QPQRRCTPHPCLLRHRARRSRQRHHPRLRSRHPQAGHBasic
NLS Segment(s)
PositionSequence
21-38HRARRSRQRHHPRLRSRH
Subcellular Location(s) nucl 12, mito 6.5, cyto_mito 5, plas 3, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPQARQQPQRRCTPHPCLLRHRARRSRQRHHPRLRSRHPQAGHIAIKPWTRMGESCGNTHVCRLIRHSVGHLLLLPISCFSFLRIHVLFTLFLCFLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.75
4 0.73
5 0.77
6 0.79
7 0.8
8 0.82
9 0.82
10 0.84
11 0.87
12 0.88
13 0.89
14 0.89
15 0.9
16 0.91
17 0.92
18 0.92
19 0.92
20 0.93
21 0.92
22 0.91
23 0.86
24 0.83
25 0.74
26 0.67
27 0.61
28 0.57
29 0.5
30 0.4
31 0.34
32 0.3
33 0.29
34 0.25
35 0.22
36 0.15
37 0.13
38 0.13
39 0.16
40 0.2
41 0.21
42 0.21
43 0.23
44 0.25
45 0.24
46 0.24
47 0.24
48 0.18
49 0.18
50 0.22
51 0.24
52 0.25
53 0.26
54 0.27
55 0.28
56 0.26
57 0.26
58 0.22
59 0.17
60 0.15
61 0.14
62 0.12
63 0.08
64 0.08
65 0.08
66 0.08
67 0.1
68 0.12
69 0.12
70 0.19
71 0.18
72 0.2
73 0.2
74 0.22
75 0.2
76 0.18
77 0.21