Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I661

Protein Details
Accession A0A1Y2I661    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-88APRNSSTLLRRRPRRAMPPRSPLRLPRHydrophilic
NLS Segment(s)
PositionSequence
46-90LPSARPPRRSNTSARRAPRNSSTLLRRRPRRAMPPRSPLRLPRRT
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MFTRLVATRSAAARPASLVAPTVTRVAAVRCYSDDAGAIRSAKGSLPSARPPRRSNTSARRAPRNSSTLLRRRPRRAMPPRSPLRLPRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.16
4 0.15
5 0.14
6 0.11
7 0.11
8 0.12
9 0.12
10 0.1
11 0.1
12 0.1
13 0.1
14 0.14
15 0.14
16 0.14
17 0.14
18 0.17
19 0.17
20 0.17
21 0.16
22 0.12
23 0.13
24 0.13
25 0.12
26 0.09
27 0.09
28 0.09
29 0.08
30 0.09
31 0.1
32 0.11
33 0.14
34 0.21
35 0.31
36 0.37
37 0.42
38 0.44
39 0.48
40 0.53
41 0.54
42 0.56
43 0.56
44 0.6
45 0.62
46 0.65
47 0.68
48 0.64
49 0.66
50 0.64
51 0.57
52 0.51
53 0.5
54 0.54
55 0.54
56 0.61
57 0.65
58 0.68
59 0.72
60 0.77
61 0.79
62 0.81
63 0.82
64 0.83
65 0.84
66 0.85
67 0.86
68 0.84
69 0.81
70 0.8