Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HXN5

Protein Details
Accession A0A1Y2HXN5    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-27VNKAYTYKPRLSRAHKKRVVHydrophilic
NLS Segment(s)
PositionSequence
17-29RLSRAHKKRVVAA
54-71KSNKKRANRGLARAIEKL
149-159VRRSTRRSLKK
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPGGKHAVNKAYTYKPRLSRAHKKRVVAAKTATSGGIVKRKSSTSGVIPSNIEKSNKKRANRGLARAIEKLKESGAFNKATKSGAVAGSSAGKKAVAKDVDGDVEMKEAEHEIIVTKKAKAPKKATAAAAVADDDSMDVDAEPAAKPAVRRSTRRSLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.61
4 0.67
5 0.71
6 0.73
7 0.76
8 0.81
9 0.8
10 0.76
11 0.76
12 0.77
13 0.71
14 0.66
15 0.6
16 0.53
17 0.49
18 0.46
19 0.37
20 0.28
21 0.26
22 0.23
23 0.25
24 0.21
25 0.21
26 0.23
27 0.24
28 0.26
29 0.27
30 0.27
31 0.25
32 0.31
33 0.31
34 0.3
35 0.3
36 0.28
37 0.3
38 0.29
39 0.27
40 0.26
41 0.3
42 0.39
43 0.45
44 0.46
45 0.51
46 0.56
47 0.64
48 0.65
49 0.66
50 0.63
51 0.61
52 0.62
53 0.56
54 0.5
55 0.4
56 0.34
57 0.28
58 0.2
59 0.17
60 0.15
61 0.15
62 0.17
63 0.18
64 0.18
65 0.19
66 0.19
67 0.17
68 0.16
69 0.13
70 0.12
71 0.1
72 0.11
73 0.09
74 0.09
75 0.12
76 0.12
77 0.11
78 0.09
79 0.09
80 0.09
81 0.1
82 0.15
83 0.13
84 0.13
85 0.15
86 0.16
87 0.16
88 0.16
89 0.15
90 0.09
91 0.09
92 0.09
93 0.07
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.06
100 0.07
101 0.11
102 0.12
103 0.13
104 0.17
105 0.25
106 0.31
107 0.39
108 0.44
109 0.5
110 0.56
111 0.61
112 0.59
113 0.56
114 0.5
115 0.42
116 0.36
117 0.28
118 0.19
119 0.14
120 0.12
121 0.07
122 0.06
123 0.05
124 0.05
125 0.04
126 0.04
127 0.05
128 0.06
129 0.06
130 0.07
131 0.07
132 0.09
133 0.1
134 0.17
135 0.28
136 0.34
137 0.41
138 0.48
139 0.59