Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HVL6

Protein Details
Accession A0A1Y2HVL6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-34IDTLRNIFCRPRKQNPNAPPPPKPKAMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR001608  Ala_racemase_N  
IPR029066  PLP-binding_barrel  
IPR011078  PyrdxlP_homeostasis  
Gene Ontology GO:0030170  F:pyridoxal phosphate binding  
Pfam View protein in Pfam  
PF01168  Ala_racemase_N  
PROSITE View protein in PROSITE  
PS01211  UPF0001  
CDD cd06822  PLPDE_III_YBL036c_euk  
Amino Acid Sequences MPMNPSVIDTLRNIFCRPRKQNPNAPPPPKPKAMSSPPSTAPIEPATAERSETLKANFDVITSHLTTAAQAADRSPADVRLVAVSKTKPASDILSLHTSTGHLHFGENYVQELVEKAAQLPSTLQWHFIGHVQSNKAKLIAPIPNLYVVETLDSAKLAKELNKHRAAKDGLSRLKVFVQVNTSAEDSKSGIKSYDQLAEIASVVVDECPSLQLAGLMTIGEPGMGERDFSRLAEWAGKLEKEGKVSGKLELSMGMSDDYELAIKHGSTNVRVGSALFGARMYPPGKGPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.5
4 0.57
5 0.62
6 0.68
7 0.75
8 0.83
9 0.85
10 0.88
11 0.88
12 0.87
13 0.86
14 0.83
15 0.81
16 0.78
17 0.7
18 0.65
19 0.64
20 0.66
21 0.65
22 0.62
23 0.61
24 0.56
25 0.58
26 0.54
27 0.44
28 0.38
29 0.31
30 0.27
31 0.22
32 0.21
33 0.19
34 0.17
35 0.18
36 0.16
37 0.16
38 0.16
39 0.18
40 0.18
41 0.2
42 0.2
43 0.21
44 0.19
45 0.18
46 0.17
47 0.16
48 0.18
49 0.14
50 0.14
51 0.12
52 0.12
53 0.12
54 0.12
55 0.12
56 0.09
57 0.08
58 0.09
59 0.12
60 0.12
61 0.13
62 0.13
63 0.13
64 0.13
65 0.13
66 0.13
67 0.13
68 0.14
69 0.14
70 0.17
71 0.16
72 0.19
73 0.19
74 0.19
75 0.17
76 0.17
77 0.19
78 0.18
79 0.19
80 0.19
81 0.22
82 0.22
83 0.2
84 0.19
85 0.17
86 0.15
87 0.15
88 0.13
89 0.09
90 0.09
91 0.09
92 0.11
93 0.13
94 0.12
95 0.11
96 0.1
97 0.09
98 0.09
99 0.09
100 0.08
101 0.07
102 0.07
103 0.06
104 0.08
105 0.08
106 0.08
107 0.08
108 0.09
109 0.13
110 0.13
111 0.14
112 0.13
113 0.13
114 0.14
115 0.16
116 0.16
117 0.13
118 0.16
119 0.18
120 0.19
121 0.2
122 0.2
123 0.17
124 0.16
125 0.15
126 0.17
127 0.18
128 0.18
129 0.18
130 0.18
131 0.18
132 0.17
133 0.17
134 0.13
135 0.09
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.05
143 0.06
144 0.06
145 0.09
146 0.15
147 0.22
148 0.3
149 0.38
150 0.41
151 0.4
152 0.46
153 0.46
154 0.42
155 0.42
156 0.42
157 0.38
158 0.39
159 0.38
160 0.33
161 0.32
162 0.34
163 0.28
164 0.21
165 0.21
166 0.19
167 0.2
168 0.2
169 0.2
170 0.15
171 0.15
172 0.14
173 0.12
174 0.13
175 0.13
176 0.12
177 0.12
178 0.12
179 0.14
180 0.16
181 0.19
182 0.16
183 0.15
184 0.15
185 0.15
186 0.14
187 0.12
188 0.09
189 0.05
190 0.04
191 0.04
192 0.04
193 0.03
194 0.03
195 0.04
196 0.04
197 0.04
198 0.04
199 0.05
200 0.05
201 0.06
202 0.06
203 0.05
204 0.05
205 0.05
206 0.05
207 0.04
208 0.04
209 0.03
210 0.06
211 0.06
212 0.06
213 0.07
214 0.1
215 0.11
216 0.11
217 0.12
218 0.11
219 0.13
220 0.16
221 0.16
222 0.17
223 0.19
224 0.19
225 0.2
226 0.24
227 0.24
228 0.23
229 0.26
230 0.25
231 0.29
232 0.3
233 0.31
234 0.28
235 0.26
236 0.24
237 0.22
238 0.2
239 0.14
240 0.14
241 0.12
242 0.1
243 0.09
244 0.09
245 0.08
246 0.07
247 0.07
248 0.07
249 0.08
250 0.08
251 0.09
252 0.13
253 0.15
254 0.17
255 0.21
256 0.21
257 0.21
258 0.22
259 0.21
260 0.18
261 0.18
262 0.16
263 0.12
264 0.11
265 0.11
266 0.12
267 0.16
268 0.15
269 0.15
270 0.2