Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HX49

Protein Details
Accession A0A1Y2HX49    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-94HSSPSCPRTRLPPRLPKRRPTSPRFCSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGFKSNINPEPSRATLTRTAIIRPENAIAMDRPPNPNVTAGSSNHESPAPEFHAQPRARGPCQPGSRHSSPSCPRTRLPPRLPKRRPTSPRFCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.37
4 0.38
5 0.33
6 0.33
7 0.31
8 0.33
9 0.29
10 0.25
11 0.22
12 0.19
13 0.18
14 0.18
15 0.14
16 0.15
17 0.18
18 0.19
19 0.2
20 0.2
21 0.21
22 0.21
23 0.22
24 0.2
25 0.19
26 0.19
27 0.18
28 0.21
29 0.21
30 0.2
31 0.2
32 0.19
33 0.15
34 0.13
35 0.15
36 0.14
37 0.14
38 0.14
39 0.16
40 0.24
41 0.24
42 0.26
43 0.3
44 0.32
45 0.32
46 0.35
47 0.38
48 0.38
49 0.44
50 0.46
51 0.44
52 0.47
53 0.49
54 0.52
55 0.48
56 0.49
57 0.5
58 0.55
59 0.58
60 0.54
61 0.52
62 0.56
63 0.65
64 0.66
65 0.7
66 0.71
67 0.74
68 0.82
69 0.88
70 0.87
71 0.86
72 0.87
73 0.87
74 0.86