Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HKC2

Protein Details
Accession A0A1Y2HKC2   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLPRPPCHRQHSWPRCRPNCLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007110  Ig-like_dom  
PROSITE View protein in PROSITE  
PS50835  IG_LIKE  
Amino Acid Sequences MLPRPPCHRQHSWPRCRPNCLPASSVTKPTRSVSRRASAPGHLRRVFTCSNRSDSPGPATTWTTQGQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.84
4 0.78
5 0.76
6 0.72
7 0.64
8 0.56
9 0.49
10 0.51
11 0.45
12 0.5
13 0.42
14 0.37
15 0.36
16 0.36
17 0.41
18 0.35
19 0.39
20 0.36
21 0.39
22 0.39
23 0.4
24 0.4
25 0.36
26 0.43
27 0.44
28 0.46
29 0.44
30 0.43
31 0.41
32 0.44
33 0.43
34 0.38
35 0.38
36 0.33
37 0.37
38 0.38
39 0.42
40 0.39
41 0.37
42 0.39
43 0.35
44 0.33
45 0.3
46 0.32
47 0.28
48 0.3
49 0.29