Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2H0I3

Protein Details
Accession A0A1Y2H0I3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAGIKRCKKSRWHRICRDAAQNQKVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
Amino Acid Sequences MAGIKRCKKSRWHRICRDAAQNQKVKWVKKGNSKMVRPNMGPIGMLDRLGGQADAMGACNGSHCMGFCPENARVAWVLAANDGPRTLRRQILQWPKVLKDNNTGCRWQKDVRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.92
3 0.89
4 0.87
5 0.85
6 0.84
7 0.81
8 0.77
9 0.67
10 0.67
11 0.65
12 0.57
13 0.57
14 0.57
15 0.55
16 0.59
17 0.69
18 0.7
19 0.73
20 0.77
21 0.77
22 0.75
23 0.73
24 0.63
25 0.57
26 0.49
27 0.39
28 0.34
29 0.24
30 0.21
31 0.16
32 0.15
33 0.11
34 0.09
35 0.09
36 0.09
37 0.08
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.06
52 0.07
53 0.08
54 0.09
55 0.13
56 0.13
57 0.15
58 0.15
59 0.15
60 0.14
61 0.13
62 0.13
63 0.1
64 0.1
65 0.08
66 0.09
67 0.08
68 0.08
69 0.08
70 0.09
71 0.1
72 0.14
73 0.17
74 0.2
75 0.22
76 0.25
77 0.35
78 0.45
79 0.48
80 0.5
81 0.51
82 0.5
83 0.56
84 0.56
85 0.5
86 0.49
87 0.54
88 0.56
89 0.56
90 0.6
91 0.58
92 0.58
93 0.6