Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HPL5

Protein Details
Accession A0A1Y2HPL5    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
70-89VNPSIHAQSKRRHRPNSSPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 4.5, cyto 4, extr 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MRHIVGHIVALLALPGVKVHSEIHRPDPCPIIFIHCPQPTRCLAWRVRPRPLLQHDQVQVVASQCLSYCVNPSIHAQSKRRHRPNSSPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.06
6 0.08
7 0.13
8 0.19
9 0.22
10 0.31
11 0.36
12 0.37
13 0.38
14 0.42
15 0.37
16 0.32
17 0.29
18 0.27
19 0.23
20 0.24
21 0.31
22 0.28
23 0.3
24 0.3
25 0.33
26 0.28
27 0.31
28 0.31
29 0.29
30 0.29
31 0.37
32 0.46
33 0.47
34 0.52
35 0.52
36 0.51
37 0.53
38 0.56
39 0.54
40 0.47
41 0.49
42 0.44
43 0.41
44 0.4
45 0.31
46 0.26
47 0.19
48 0.17
49 0.1
50 0.08
51 0.07
52 0.09
53 0.1
54 0.09
55 0.12
56 0.14
57 0.15
58 0.17
59 0.2
60 0.26
61 0.33
62 0.41
63 0.44
64 0.5
65 0.6
66 0.7
67 0.76
68 0.77
69 0.78