Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HDM4

Protein Details
Accession A0A1Y2HDM4   
Localization Confidence Low
Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-31QEPWRRARRAHARARQVHACHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 8, E.R. 2, nucl 1, cyto 1, extr 1, cyto_nucl 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007241  Autophagy-rel_prot_9  
Gene Ontology GO:0030659  C:cytoplasmic vesicle membrane  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0000139  C:Golgi membrane  
GO:0034045  C:phagophore assembly site membrane  
GO:0006914  P:autophagy  
GO:0006869  P:lipid transport  
Pfam View protein in Pfam  
PF04109  ATG9  
Amino Acid Sequences MPMGWVLGLTRQEPWRRARRAHARARQVHACLSAAVGSLGVSSDRTRQEVAGMVVPRAMVYVNEVVGMLVAPLVLGVAVRSRADEIVSFVMDRTVVVPGLGCVYAGALFDGRYADAGQTPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.54
4 0.58
5 0.65
6 0.69
7 0.73
8 0.79
9 0.79
10 0.79
11 0.8
12 0.82
13 0.77
14 0.67
15 0.6
16 0.51
17 0.42
18 0.32
19 0.25
20 0.18
21 0.12
22 0.1
23 0.07
24 0.05
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.09
31 0.11
32 0.12
33 0.13
34 0.13
35 0.14
36 0.15
37 0.16
38 0.16
39 0.15
40 0.14
41 0.13
42 0.13
43 0.12
44 0.09
45 0.08
46 0.04
47 0.05
48 0.06
49 0.05
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.03
65 0.04
66 0.04
67 0.05
68 0.06
69 0.06
70 0.07
71 0.08
72 0.09
73 0.1
74 0.11
75 0.1
76 0.09
77 0.1
78 0.09
79 0.09
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.08
87 0.08
88 0.07
89 0.05
90 0.06
91 0.06
92 0.07
93 0.07
94 0.06
95 0.06
96 0.07
97 0.08
98 0.07
99 0.08
100 0.08
101 0.09
102 0.13