Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I321

Protein Details
Accession A0A1Y2I321    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-26LRPAHSCKTRPSPRPSQPCPGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
IPR000772  Ricin_B_lectin  
Pfam View protein in Pfam  
PF00652  Ricin_B_lectin  
PROSITE View protein in PROSITE  
PS50231  RICIN_B_LECTIN  
CDD cd00161  RICIN  
Amino Acid Sequences MAQPLRPAHSCKTRPSPRPSQPCPGAPTRHVFSQPIEAETLPKANTGTSAGLGVNRCLDVEQSRKTVKYSDAQMWSCNLNPDAQNRHVMLLTSMQKFSFYGSVDWSSVYIVANGAGPAPEYADYCLDVTEGKMVNGQAVRWWECNRSDAQRWTWNREHGFISPVLRPDLCLDPMGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.79
4 0.79
5 0.85
6 0.83
7 0.82
8 0.78
9 0.75
10 0.72
11 0.68
12 0.64
13 0.57
14 0.57
15 0.5
16 0.49
17 0.45
18 0.41
19 0.35
20 0.39
21 0.36
22 0.31
23 0.29
24 0.24
25 0.23
26 0.23
27 0.23
28 0.14
29 0.14
30 0.12
31 0.11
32 0.12
33 0.12
34 0.12
35 0.1
36 0.11
37 0.1
38 0.12
39 0.13
40 0.12
41 0.11
42 0.1
43 0.09
44 0.09
45 0.1
46 0.11
47 0.16
48 0.18
49 0.22
50 0.24
51 0.25
52 0.26
53 0.27
54 0.26
55 0.25
56 0.27
57 0.28
58 0.32
59 0.32
60 0.32
61 0.31
62 0.29
63 0.25
64 0.22
65 0.16
66 0.12
67 0.13
68 0.17
69 0.2
70 0.2
71 0.23
72 0.21
73 0.22
74 0.2
75 0.18
76 0.15
77 0.15
78 0.18
79 0.16
80 0.16
81 0.15
82 0.15
83 0.15
84 0.16
85 0.13
86 0.1
87 0.09
88 0.11
89 0.13
90 0.12
91 0.13
92 0.12
93 0.09
94 0.09
95 0.08
96 0.06
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.06
108 0.07
109 0.08
110 0.09
111 0.08
112 0.08
113 0.08
114 0.07
115 0.07
116 0.1
117 0.1
118 0.09
119 0.11
120 0.11
121 0.14
122 0.14
123 0.14
124 0.13
125 0.17
126 0.2
127 0.22
128 0.24
129 0.26
130 0.27
131 0.29
132 0.31
133 0.33
134 0.38
135 0.4
136 0.45
137 0.5
138 0.53
139 0.59
140 0.6
141 0.61
142 0.57
143 0.54
144 0.51
145 0.44
146 0.42
147 0.37
148 0.34
149 0.29
150 0.29
151 0.29
152 0.26
153 0.25
154 0.26
155 0.28
156 0.26
157 0.23