Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2H8R9

Protein Details
Accession A0A1Y2H8R9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
31-56VGVSRRGRHRRHDVKRRNSHRDRGDYBasic
NLS Segment(s)
PositionSequence
35-49RRGRHRRHDVKRRNS
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cysk 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPGVRAAPMTQGEVVYHEEYLEERRVNAGDVGVSRRGRHRRHDVKRRNSHRDRGDYGGFEEQGYSGGAAGLSSGSRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.14
4 0.12
5 0.12
6 0.12
7 0.15
8 0.17
9 0.13
10 0.12
11 0.14
12 0.14
13 0.15
14 0.14
15 0.11
16 0.09
17 0.09
18 0.12
19 0.15
20 0.15
21 0.15
22 0.23
23 0.31
24 0.33
25 0.4
26 0.49
27 0.55
28 0.65
29 0.75
30 0.78
31 0.81
32 0.88
33 0.9
34 0.9
35 0.86
36 0.85
37 0.82
38 0.79
39 0.73
40 0.67
41 0.6
42 0.51
43 0.47
44 0.41
45 0.33
46 0.25
47 0.21
48 0.15
49 0.13
50 0.13
51 0.09
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05