Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I3W4

Protein Details
Accession A0A1Y2I3W4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLRSTSIRRRRRNRTRRNDDTQIHNQHydrophilic
NLS Segment(s)
PositionSequence
8-15RRRRRNRT
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MLRSTSIRRRRRNRTRRNDDTQIHNQSETAHSTCRARYIAPTRARVLKEKNRRHRSACAGNRCSQPSSALHGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.93
4 0.92
5 0.9
6 0.83
7 0.8
8 0.79
9 0.74
10 0.65
11 0.55
12 0.46
13 0.38
14 0.35
15 0.29
16 0.21
17 0.15
18 0.15
19 0.16
20 0.16
21 0.18
22 0.16
23 0.13
24 0.18
25 0.23
26 0.3
27 0.34
28 0.38
29 0.38
30 0.43
31 0.44
32 0.44
33 0.47
34 0.48
35 0.54
36 0.61
37 0.7
38 0.74
39 0.79
40 0.78
41 0.78
42 0.77
43 0.77
44 0.76
45 0.76
46 0.72
47 0.72
48 0.73
49 0.68
50 0.61
51 0.51
52 0.45
53 0.37