Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HHQ6

Protein Details
Accession A0A1Y2HHQ6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-44TPKVDKQADKKKPKTGRAKKRIIYTRRBasic
NLS Segment(s)
PositionSequence
11-40AGKVKGQTPKVDKQADKKKPKTGRAKKRII
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences QGKVHGSLARAGKVKGQTPKVDKQADKKKPKTGRAKKRIIYTRRFVNAPVLFGGKRKMNPAPNQKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.41
4 0.44
5 0.48
6 0.55
7 0.58
8 0.61
9 0.58
10 0.6
11 0.66
12 0.68
13 0.72
14 0.7
15 0.72
16 0.73
17 0.79
18 0.8
19 0.8
20 0.81
21 0.81
22 0.84
23 0.8
24 0.81
25 0.81
26 0.77
27 0.74
28 0.69
29 0.67
30 0.62
31 0.58
32 0.49
33 0.49
34 0.43
35 0.37
36 0.32
37 0.27
38 0.24
39 0.25
40 0.28
41 0.24
42 0.25
43 0.29
44 0.35
45 0.41
46 0.5