Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I067

Protein Details
Accession A0A1Y2I067   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VNIPKTRNTFCKGKKCRKHTPHKVTQYKTGKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto_nucl 8, nucl 7.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRNTFCKGKKCRKHTPHKVTQYKTGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECTSCKYKMQISLKRCKHFELGGEKKQKGQALQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.83
4 0.89
5 0.89
6 0.91
7 0.91
8 0.91
9 0.91
10 0.92
11 0.92
12 0.85
13 0.85
14 0.81
15 0.75
16 0.67
17 0.61
18 0.51
19 0.43
20 0.42
21 0.39
22 0.37
23 0.36
24 0.41
25 0.43
26 0.47
27 0.51
28 0.55
29 0.53
30 0.56
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.28
46 0.33
47 0.38
48 0.47
49 0.55
50 0.6
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.63
58 0.6
59 0.59
60 0.54
61 0.49
62 0.45
63 0.4
64 0.35
65 0.33
66 0.32
67 0.35
68 0.43
69 0.47
70 0.51
71 0.6
72 0.66
73 0.71
74 0.69
75 0.64
76 0.59
77 0.53
78 0.53
79 0.53
80 0.53
81 0.55
82 0.62
83 0.59
84 0.59
85 0.61
86 0.57