Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2H4D3

Protein Details
Accession A0A1Y2H4D3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
102-122RKLNHDSKPKPAFFRRKKGGGBasic
NLS Segment(s)
PositionSequence
109-122KPKPAFFRRKKGGG
Subcellular Location(s) mito 18.5, mito_nucl 12.333, nucl 5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR035935  TFB5-like_sf  
IPR009400  TFIIH_TTDA/Tfb5  
Gene Ontology GO:0000439  C:transcription factor TFIIH core complex  
GO:0005675  C:transcription factor TFIIH holo complex  
GO:0006289  P:nucleotide-excision repair  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF06331  Tfb5  
Amino Acid Sequences MSVPLRATLAPAGRPSQPPSSSLQPPKGPTSTLVNFKGRLLECSDPVVRDLILMYEQQRKAKGLEGIIVYEKVGDRHLFVRDDEAALRGVEEFVRKTLEDSRKLNHDSKPKPAFFRRKKGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.35
4 0.34
5 0.33
6 0.36
7 0.4
8 0.45
9 0.48
10 0.5
11 0.47
12 0.5
13 0.53
14 0.48
15 0.43
16 0.36
17 0.38
18 0.35
19 0.37
20 0.38
21 0.36
22 0.35
23 0.35
24 0.39
25 0.31
26 0.28
27 0.26
28 0.23
29 0.21
30 0.25
31 0.25
32 0.19
33 0.19
34 0.18
35 0.13
36 0.11
37 0.1
38 0.06
39 0.06
40 0.07
41 0.09
42 0.15
43 0.17
44 0.18
45 0.19
46 0.2
47 0.2
48 0.22
49 0.22
50 0.15
51 0.17
52 0.16
53 0.16
54 0.15
55 0.15
56 0.11
57 0.1
58 0.09
59 0.07
60 0.08
61 0.07
62 0.08
63 0.1
64 0.13
65 0.14
66 0.14
67 0.17
68 0.16
69 0.16
70 0.15
71 0.14
72 0.12
73 0.11
74 0.11
75 0.08
76 0.08
77 0.08
78 0.09
79 0.09
80 0.09
81 0.12
82 0.12
83 0.14
84 0.22
85 0.29
86 0.34
87 0.37
88 0.4
89 0.46
90 0.51
91 0.54
92 0.52
93 0.55
94 0.53
95 0.6
96 0.65
97 0.63
98 0.66
99 0.72
100 0.76
101 0.75
102 0.82