Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HNN1

Protein Details
Accession A0A1Y2HNN1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
157-182LRAKPHPKSWTPKPPRLQKRATTALKHydrophilic
NLS Segment(s)
PositionSequence
143-176SPRALRLLPARVAPLRAKPHPKSWTPKPPRLQKR
Subcellular Location(s) mito 16, cyto 7, pero 2
Family & Domain DBs
Amino Acid Sequences MLATAPVPVSAPGQVPPPAYSTALLPIVRVSSVLGAQTAPNTVLGMERGAVKLVTLSPAAEAKIIEVRLLPLVDNKPAANPATQMDLAKLAADTAPLMVFFPGSKLYLGSAAGKKLMFSMRAVPLQAWAVVRPARPNPPVRQSPRALRLLPARVAPLRAKPHPKSWTPKPPRLQKRATTALKLPCPWPSSTRTACNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.21
5 0.21
6 0.21
7 0.21
8 0.18
9 0.19
10 0.22
11 0.2
12 0.18
13 0.17
14 0.16
15 0.16
16 0.14
17 0.11
18 0.08
19 0.09
20 0.09
21 0.08
22 0.08
23 0.09
24 0.09
25 0.09
26 0.08
27 0.08
28 0.07
29 0.07
30 0.07
31 0.08
32 0.07
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.07
39 0.08
40 0.08
41 0.08
42 0.08
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.08
49 0.08
50 0.11
51 0.11
52 0.1
53 0.09
54 0.09
55 0.1
56 0.1
57 0.09
58 0.11
59 0.12
60 0.13
61 0.14
62 0.13
63 0.13
64 0.14
65 0.15
66 0.11
67 0.11
68 0.1
69 0.13
70 0.13
71 0.13
72 0.11
73 0.11
74 0.1
75 0.09
76 0.08
77 0.05
78 0.05
79 0.05
80 0.04
81 0.03
82 0.03
83 0.03
84 0.04
85 0.03
86 0.03
87 0.03
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.06
94 0.07
95 0.07
96 0.1
97 0.11
98 0.1
99 0.12
100 0.12
101 0.11
102 0.12
103 0.13
104 0.11
105 0.1
106 0.15
107 0.16
108 0.18
109 0.18
110 0.16
111 0.16
112 0.16
113 0.16
114 0.12
115 0.09
116 0.11
117 0.13
118 0.14
119 0.17
120 0.2
121 0.25
122 0.29
123 0.35
124 0.38
125 0.44
126 0.53
127 0.56
128 0.6
129 0.58
130 0.62
131 0.63
132 0.62
133 0.54
134 0.49
135 0.5
136 0.48
137 0.45
138 0.37
139 0.34
140 0.3
141 0.33
142 0.31
143 0.32
144 0.34
145 0.4
146 0.48
147 0.48
148 0.56
149 0.6
150 0.65
151 0.66
152 0.7
153 0.74
154 0.74
155 0.79
156 0.79
157 0.83
158 0.86
159 0.87
160 0.85
161 0.81
162 0.81
163 0.82
164 0.78
165 0.73
166 0.69
167 0.69
168 0.66
169 0.61
170 0.54
171 0.51
172 0.48
173 0.45
174 0.43
175 0.4
176 0.42
177 0.46