Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I1S0

Protein Details
Accession A0A1Y2I1S0    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-53LAPHRHSTRHSPRPQPRDFPRAPRHPRCAHBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPTLGAGGVPGRAPSNTDATAHPLAPHRHSTRHSPRPQPRDFPRAPRHPRCAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.16
4 0.17
5 0.17
6 0.22
7 0.23
8 0.21
9 0.2
10 0.21
11 0.22
12 0.23
13 0.29
14 0.26
15 0.29
16 0.31
17 0.4
18 0.45
19 0.54
20 0.59
21 0.63
22 0.71
23 0.76
24 0.8
25 0.8
26 0.77
27 0.76
28 0.74
29 0.74
30 0.74
31 0.76
32 0.8
33 0.8