Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HU03

Protein Details
Accession A0A1Y2HU03    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-129LAEEAKTGRKQRKERKNRAKKARGKAKAIVLBasic
NLS Segment(s)
PositionSequence
103-133AKTGRKQRKERKNRAKKARGKAKAIVLGHRK
Subcellular Location(s) mito 17, cyto 7, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MAVDASSATIRTRKYLTNRLLQRKQMVVDVLHANIANVPKDTIREKLAKMYKVEKDLVVAFGFRTAFGGGKSTGFALIYDSIDSLKKFEPKYRLVRLGLAEEAKTGRKQRKERKNRAKKARGKAKAIVLGHRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.48
4 0.54
5 0.63
6 0.7
7 0.74
8 0.73
9 0.69
10 0.63
11 0.59
12 0.52
13 0.45
14 0.35
15 0.32
16 0.28
17 0.23
18 0.2
19 0.18
20 0.15
21 0.14
22 0.15
23 0.12
24 0.1
25 0.11
26 0.1
27 0.13
28 0.15
29 0.16
30 0.18
31 0.21
32 0.21
33 0.29
34 0.35
35 0.35
36 0.37
37 0.4
38 0.4
39 0.4
40 0.4
41 0.31
42 0.28
43 0.25
44 0.23
45 0.16
46 0.13
47 0.09
48 0.09
49 0.09
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.09
70 0.09
71 0.09
72 0.11
73 0.16
74 0.17
75 0.23
76 0.29
77 0.35
78 0.44
79 0.49
80 0.52
81 0.48
82 0.5
83 0.46
84 0.43
85 0.38
86 0.31
87 0.24
88 0.19
89 0.19
90 0.18
91 0.2
92 0.25
93 0.31
94 0.39
95 0.49
96 0.59
97 0.69
98 0.78
99 0.85
100 0.9
101 0.93
102 0.94
103 0.95
104 0.95
105 0.94
106 0.94
107 0.93
108 0.91
109 0.86
110 0.83
111 0.8
112 0.77
113 0.7