Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HJ55

Protein Details
Accession A0A1Y2HJ55    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
64-87RTVPCKPHQKGQPGRSRDRRGCAHBasic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 9, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017896  4Fe4S_Fe-S-bd  
PROSITE View protein in PROSITE  
PS51379  4FE4S_FER_2  
Amino Acid Sequences MSGLESALCTCPALLLAIASLRMKCKIYMQFTNVYHARACTGMCGLCVNMCAVGSISSSDLQLRTVPCKPHQKGQPGRSRDRRGCAHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.08
6 0.09
7 0.09
8 0.1
9 0.12
10 0.13
11 0.14
12 0.19
13 0.25
14 0.31
15 0.35
16 0.37
17 0.42
18 0.41
19 0.47
20 0.42
21 0.36
22 0.29
23 0.25
24 0.22
25 0.15
26 0.14
27 0.08
28 0.09
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.06
36 0.05
37 0.05
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.11
50 0.12
51 0.16
52 0.2
53 0.24
54 0.31
55 0.42
56 0.44
57 0.51
58 0.57
59 0.63
60 0.68
61 0.74
62 0.77
63 0.74
64 0.81
65 0.83
66 0.85
67 0.82
68 0.8