Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HPV7

Protein Details
Accession A0A1Y2HPV7    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
374-409LPWAGRQQARRQRAQRMVKSSRSRPCRCRCGQWWLGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, extr 8, cyto_nucl 7, nucl 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013745  Bit61/PRR5  
Pfam View protein in Pfam  
PF08539  HbrB  
Amino Acid Sequences MNENWVNINSSLSNHLILFHHVAEQMGRVKDGRKALGLDKLDPPAVHASDDGTTSSDPQLQLTSPTTTAGTASSSATAAPPPTGGHTATAAVNNAHLTSVIAPFLNPRLSTSSSIAGLAPPLPGGPPASAPSPTSPRSPTFQQQHHLFDSASDGVGDQVWDTIESRVLPLFVGEGLNSTVEEINFLLSRYLAQQLYGTILEELKDLLREGVHRLMAKFLTPDVVFPDPLVSIGMPSLAAPAVPASQSKYLIRWTEIWTFYFSVVLPYLQSVFLPLQAEIKGSRLVNSVRTLVLLAFRDRAVLPHIDSIQVLVGALAAEFSPTTTSTHRAGVRISTLSISSLTPAAQQEPSATATPMAEARIAQLQQMLLVLGDLPWAGRQQARRQRAQRMVKSSRSRPCRCRCGQWWLGSGRRLLQQEVSGGCKWWGVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.19
4 0.21
5 0.22
6 0.19
7 0.2
8 0.19
9 0.2
10 0.18
11 0.2
12 0.23
13 0.21
14 0.22
15 0.21
16 0.23
17 0.28
18 0.34
19 0.32
20 0.29
21 0.32
22 0.34
23 0.41
24 0.41
25 0.39
26 0.37
27 0.37
28 0.36
29 0.32
30 0.32
31 0.29
32 0.27
33 0.24
34 0.2
35 0.19
36 0.18
37 0.19
38 0.17
39 0.13
40 0.12
41 0.13
42 0.15
43 0.17
44 0.16
45 0.16
46 0.17
47 0.16
48 0.19
49 0.2
50 0.21
51 0.17
52 0.18
53 0.18
54 0.16
55 0.16
56 0.13
57 0.12
58 0.1
59 0.1
60 0.1
61 0.1
62 0.1
63 0.1
64 0.11
65 0.1
66 0.09
67 0.09
68 0.09
69 0.12
70 0.14
71 0.14
72 0.14
73 0.14
74 0.16
75 0.16
76 0.17
77 0.15
78 0.12
79 0.13
80 0.12
81 0.11
82 0.09
83 0.08
84 0.07
85 0.08
86 0.09
87 0.09
88 0.08
89 0.08
90 0.1
91 0.13
92 0.15
93 0.13
94 0.14
95 0.18
96 0.21
97 0.24
98 0.25
99 0.24
100 0.22
101 0.23
102 0.21
103 0.16
104 0.14
105 0.11
106 0.09
107 0.07
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.08
114 0.1
115 0.12
116 0.13
117 0.14
118 0.17
119 0.21
120 0.22
121 0.25
122 0.26
123 0.27
124 0.31
125 0.34
126 0.39
127 0.42
128 0.45
129 0.49
130 0.5
131 0.52
132 0.5
133 0.46
134 0.37
135 0.3
136 0.28
137 0.21
138 0.16
139 0.11
140 0.09
141 0.08
142 0.08
143 0.07
144 0.04
145 0.04
146 0.04
147 0.05
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.06
157 0.06
158 0.05
159 0.05
160 0.04
161 0.05
162 0.05
163 0.06
164 0.05
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.06
171 0.06
172 0.07
173 0.06
174 0.05
175 0.06
176 0.07
177 0.1
178 0.09
179 0.09
180 0.09
181 0.09
182 0.11
183 0.1
184 0.09
185 0.06
186 0.07
187 0.07
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.06
196 0.08
197 0.1
198 0.11
199 0.12
200 0.12
201 0.14
202 0.13
203 0.13
204 0.11
205 0.09
206 0.1
207 0.09
208 0.09
209 0.1
210 0.11
211 0.11
212 0.1
213 0.11
214 0.08
215 0.08
216 0.09
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.03
223 0.04
224 0.03
225 0.03
226 0.03
227 0.04
228 0.04
229 0.05
230 0.05
231 0.07
232 0.09
233 0.11
234 0.12
235 0.13
236 0.16
237 0.18
238 0.19
239 0.19
240 0.22
241 0.26
242 0.27
243 0.27
244 0.25
245 0.24
246 0.23
247 0.2
248 0.16
249 0.11
250 0.11
251 0.1
252 0.07
253 0.07
254 0.08
255 0.07
256 0.07
257 0.07
258 0.07
259 0.09
260 0.09
261 0.09
262 0.1
263 0.1
264 0.12
265 0.1
266 0.12
267 0.13
268 0.12
269 0.13
270 0.15
271 0.16
272 0.18
273 0.2
274 0.2
275 0.17
276 0.17
277 0.16
278 0.13
279 0.15
280 0.14
281 0.13
282 0.13
283 0.13
284 0.14
285 0.14
286 0.14
287 0.14
288 0.14
289 0.14
290 0.16
291 0.17
292 0.16
293 0.16
294 0.15
295 0.13
296 0.11
297 0.09
298 0.05
299 0.05
300 0.04
301 0.04
302 0.04
303 0.03
304 0.03
305 0.03
306 0.04
307 0.05
308 0.06
309 0.08
310 0.1
311 0.14
312 0.15
313 0.21
314 0.23
315 0.23
316 0.24
317 0.24
318 0.26
319 0.23
320 0.22
321 0.17
322 0.16
323 0.15
324 0.15
325 0.13
326 0.1
327 0.1
328 0.09
329 0.11
330 0.12
331 0.13
332 0.13
333 0.13
334 0.13
335 0.15
336 0.18
337 0.16
338 0.16
339 0.14
340 0.13
341 0.14
342 0.14
343 0.13
344 0.1
345 0.09
346 0.11
347 0.15
348 0.15
349 0.15
350 0.15
351 0.14
352 0.14
353 0.14
354 0.12
355 0.07
356 0.07
357 0.06
358 0.04
359 0.05
360 0.04
361 0.04
362 0.05
363 0.06
364 0.08
365 0.12
366 0.18
367 0.29
368 0.39
369 0.47
370 0.56
371 0.62
372 0.71
373 0.77
374 0.82
375 0.8
376 0.81
377 0.82
378 0.82
379 0.84
380 0.83
381 0.83
382 0.82
383 0.83
384 0.83
385 0.85
386 0.86
387 0.83
388 0.84
389 0.81
390 0.81
391 0.8
392 0.77
393 0.74
394 0.7
395 0.7
396 0.63
397 0.58
398 0.52
399 0.51
400 0.46
401 0.4
402 0.37
403 0.33
404 0.34
405 0.35
406 0.35
407 0.3
408 0.29
409 0.27