FuNGI

A0A1Y2HPV7

Protein Details

Accession

A0A1Y2HPV7

Localization Confidence

Low

Confidence Score

6.5

NoLS Segment(s)

Position	Sequence	Protein Nature
374-409	LPWAGRQQARRQRAQRMVKSSRSRPCRCRCGQWWLG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 8.5, extr 8, cyto_nucl 7, nucl 4.5, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR013745 Bit61/PRR5
Pfam	View protein in Pfam PF08539 HbrB

Amino Acid Sequences

MNENWVNINSSLSNHLILFHHVAEQMGRVKDGRKALGLDKLDPPAVHASDDGTTSSDPQLQLTSPTTTAGTASSSATAAPPPTGGHTATAAVNNAHLTSVIAPFLNPRLSTSSSIAGLAPPLPGGPPASAPSPTSPRSPTFQQQHHLFDSASDGVGDQVWDTIESRVLPLFVGEGLNSTVEEINFLLSRYLAQQLYGTILEELKDLLREGVHRLMAKFLTPDVVFPDPLVSIGMPSLAAPAVPASQSKYLIRWTEIWTFYFSVVLPYLQSVFLPLQAEIKGSRLVNSVRTLVLLAFRDRAVLPHIDSIQVLVGALAAEFSPTTTSTHRAGVRISTLSISSLTPAAQQEPSATATPMAEARIAQLQQMLLVLGDLPWAGRQQARRQRAQRMVKSSRSRPCRCRCGQWWLGSGRRLLQQEVSGGCKWWGVS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.2
3	0.19
4	0.21
5	0.22
6	0.19
7	0.2
8	0.19
9	0.2
10	0.18
11	0.2
12	0.23
13	0.21
14	0.22
15	0.21
16	0.23
17	0.28
18	0.34
19	0.32
20	0.29
21	0.32
22	0.34
23	0.41
24	0.41
25	0.39
26	0.37
27	0.37
28	0.36
29	0.32
30	0.32
31	0.29
32	0.27
33	0.24
34	0.2
35	0.19
36	0.18
37	0.19
38	0.17
39	0.13
40	0.12
41	0.13
42	0.15
43	0.17
44	0.16
45	0.16
46	0.17
47	0.16
48	0.19
49	0.2
50	0.21
51	0.17
52	0.18
53	0.18
54	0.16
55	0.16
56	0.13
57	0.12
58	0.1
59	0.1
60	0.1
61	0.1
62	0.1
63	0.1
64	0.11
65	0.1
66	0.09
67	0.09
68	0.09
69	0.12
70	0.14
71	0.14
72	0.14
73	0.14
74	0.16
75	0.16
76	0.17
77	0.15
78	0.12
79	0.13
80	0.12
81	0.11
82	0.09
83	0.08
84	0.07
85	0.08
86	0.09
87	0.09
88	0.08
89	0.08
90	0.1
91	0.13
92	0.15
93	0.13
94	0.14
95	0.18
96	0.21
97	0.24
98	0.25
99	0.24
100	0.22
101	0.23
102	0.21
103	0.16
104	0.14
105	0.11
106	0.09
107	0.07
108	0.06
109	0.06
110	0.06
111	0.07
112	0.07
113	0.08
114	0.1
115	0.12
116	0.13
117	0.14
118	0.17
119	0.21
120	0.22
121	0.25
122	0.26
123	0.27
124	0.31
125	0.34
126	0.39
127	0.42
128	0.45
129	0.49
130	0.5
131	0.52
132	0.5
133	0.46
134	0.37
135	0.3
136	0.28
137	0.21
138	0.16
139	0.11
140	0.09
141	0.08
142	0.08
143	0.07
144	0.04
145	0.04
146	0.04
147	0.05
148	0.06
149	0.06
150	0.07
151	0.07
152	0.07
153	0.07
154	0.07
155	0.07
156	0.06
157	0.06
158	0.05
159	0.05
160	0.04
161	0.05
162	0.05
163	0.06
164	0.05
165	0.06
166	0.06
167	0.06
168	0.06
169	0.05
170	0.06
171	0.06
172	0.07
173	0.06
174	0.05
175	0.06
176	0.07
177	0.1
178	0.09
179	0.09
180	0.09
181	0.09
182	0.11
183	0.1
184	0.09
185	0.06
186	0.07
187	0.07
188	0.06
189	0.06
190	0.05
191	0.05
192	0.05
193	0.05
194	0.05
195	0.06
196	0.08
197	0.1
198	0.11
199	0.12
200	0.12
201	0.14
202	0.13
203	0.13
204	0.11
205	0.09
206	0.1
207	0.09
208	0.09
209	0.1
210	0.11
211	0.11
212	0.1
213	0.11
214	0.08
215	0.08
216	0.09
217	0.05
218	0.04
219	0.04
220	0.04
221	0.04
222	0.03
223	0.04
224	0.03
225	0.03
226	0.03
227	0.04
228	0.04
229	0.05
230	0.05
231	0.07
232	0.09
233	0.11
234	0.12
235	0.13
236	0.16
237	0.18
238	0.19
239	0.19
240	0.22
241	0.26
242	0.27
243	0.27
244	0.25
245	0.24
246	0.23
247	0.2
248	0.16
249	0.11
250	0.11
251	0.1
252	0.07
253	0.07
254	0.08
255	0.07
256	0.07
257	0.07
258	0.07
259	0.09
260	0.09
261	0.09
262	0.1
263	0.1
264	0.12
265	0.1
266	0.12
267	0.13
268	0.12
269	0.13
270	0.15
271	0.16
272	0.18
273	0.2
274	0.2
275	0.17
276	0.17
277	0.16
278	0.13
279	0.15
280	0.14
281	0.13
282	0.13
283	0.13
284	0.14
285	0.14
286	0.14
287	0.14
288	0.14
289	0.14
290	0.16
291	0.17
292	0.16
293	0.16
294	0.15
295	0.13
296	0.11
297	0.09
298	0.05
299	0.05
300	0.04
301	0.04
302	0.04
303	0.03
304	0.03
305	0.03
306	0.04
307	0.05
308	0.06
309	0.08
310	0.1
311	0.14
312	0.15
313	0.21
314	0.23
315	0.23
316	0.24
317	0.24
318	0.26
319	0.23
320	0.22
321	0.17
322	0.16
323	0.15
324	0.15
325	0.13
326	0.1
327	0.1
328	0.09
329	0.11
330	0.12
331	0.13
332	0.13
333	0.13
334	0.13
335	0.15
336	0.18
337	0.16
338	0.16
339	0.14
340	0.13
341	0.14
342	0.14
343	0.13
344	0.1
345	0.09
346	0.11
347	0.15
348	0.15
349	0.15
350	0.15
351	0.14
352	0.14
353	0.14
354	0.12
355	0.07
356	0.07
357	0.06
358	0.04
359	0.05
360	0.04
361	0.04
362	0.05
363	0.06
364	0.08
365	0.12
366	0.18
367	0.29
368	0.39
369	0.47
370	0.56
371	0.62
372	0.71
373	0.77
374	0.82
375	0.8
376	0.81
377	0.82
378	0.82
379	0.84
380	0.83
381	0.83
382	0.82
383	0.83
384	0.83
385	0.85
386	0.86
387	0.83
388	0.84
389	0.81
390	0.81
391	0.8
392	0.77
393	0.74
394	0.7
395	0.7
396	0.63
397	0.58
398	0.52
399	0.51
400	0.46
401	0.4
402	0.37
403	0.33
404	0.34
405	0.35
406	0.35
407	0.3
408	0.29
409	0.27

A0A1Y2HPV7

3D AlphaFold-predicted Structure Viewer