Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HV99

Protein Details
Accession A0A1Y2HV99    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-69DRRVKHVWPRPSHSRRPRREGSPQFETBasic
NLS Segment(s)
PositionSequence
51-61PRPSHSRRPRR
Subcellular Location(s) plas 11, mito 8, extr 3, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSMGKPYATLPTELVMSVLAQACPRVLLVAVSSVIPKLVAADRRVKHVWPRPSHSRRPRREGSPQFETW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.1
4 0.08
5 0.09
6 0.09
7 0.08
8 0.07
9 0.08
10 0.07
11 0.07
12 0.07
13 0.05
14 0.05
15 0.04
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.05
26 0.07
27 0.11
28 0.13
29 0.22
30 0.23
31 0.29
32 0.31
33 0.31
34 0.38
35 0.43
36 0.5
37 0.49
38 0.56
39 0.61
40 0.69
41 0.78
42 0.8
43 0.82
44 0.82
45 0.84
46 0.84
47 0.81
48 0.84
49 0.83
50 0.81