Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HE40

Protein Details
Accession A0A1Y2HE40    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-37RHKGRSKAQVYQEKKQRKQRKYLSSRERRSLGBasic
NLS Segment(s)
PositionSequence
19-26KKQRKQRK
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR016848  RNase_P/MRP_Rpp29-subunit  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023534  Rof/RNase_P-like  
IPR002730  Rpp29/RNP1  
Gene Ontology GO:0000172  C:ribonuclease MRP complex  
GO:0030677  C:ribonuclease P complex  
GO:0033204  F:ribonuclease P RNA binding  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01868  RNase_P-MRP_p29  
Amino Acid Sequences MPEQFRHKGRSKAQVYQEKKQRKQRKYLSSRERRSLGLMTLPTNSIIFAAMKPLQHLWNQYMDDLKSGGAADQFMAKLIKADFHGAHMTVTQATCPTLIGISGIVVQETAKTFNLVTQQNVVKSICKQGTVFSVVIGQMVYHLYGHQLQYRSSERAARKFKGKPTIEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.76
4 0.79
5 0.79
6 0.81
7 0.84
8 0.84
9 0.82
10 0.86
11 0.87
12 0.88
13 0.87
14 0.89
15 0.89
16 0.9
17 0.89
18 0.86
19 0.78
20 0.68
21 0.62
22 0.53
23 0.44
24 0.38
25 0.31
26 0.25
27 0.24
28 0.23
29 0.19
30 0.17
31 0.15
32 0.09
33 0.09
34 0.08
35 0.07
36 0.1
37 0.12
38 0.12
39 0.13
40 0.15
41 0.16
42 0.17
43 0.2
44 0.18
45 0.21
46 0.21
47 0.2
48 0.21
49 0.19
50 0.18
51 0.16
52 0.13
53 0.09
54 0.08
55 0.08
56 0.06
57 0.06
58 0.05
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.08
67 0.07
68 0.1
69 0.09
70 0.11
71 0.12
72 0.1
73 0.11
74 0.09
75 0.09
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.04
92 0.04
93 0.04
94 0.05
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.09
101 0.16
102 0.16
103 0.17
104 0.2
105 0.22
106 0.22
107 0.24
108 0.23
109 0.2
110 0.2
111 0.27
112 0.23
113 0.23
114 0.22
115 0.22
116 0.25
117 0.27
118 0.25
119 0.18
120 0.18
121 0.16
122 0.16
123 0.14
124 0.1
125 0.06
126 0.07
127 0.07
128 0.06
129 0.06
130 0.08
131 0.11
132 0.13
133 0.18
134 0.19
135 0.2
136 0.26
137 0.3
138 0.32
139 0.32
140 0.38
141 0.4
142 0.48
143 0.55
144 0.55
145 0.59
146 0.63
147 0.69
148 0.72