Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HDQ1

Protein Details
Accession A0A1Y2HDQ1    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-105KAEKKMYRSRAKNKPDLQKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045242  Syntaxin  
IPR000727  T_SNARE_dom  
PROSITE View protein in PROSITE  
PS50192  T_SNARE  
CDD cd15841  SNARE_Qc  
Amino Acid Sequences MTSMKDAMKRLTVIHQACCPQENNEKPDMDEFTRIKKEIAAKVKEARQLIKERNDILKADKSSRRIRSVLKAIKEDINSLDANVQKAEKKMYRSRAKNKPDLQKFSTRAKKSSSVCRSHLEECENLDRERFNDKVAGDRANLFASGGGGAAASPSSALKFGKFGAAAVSPGMPPPSPGSSAIAEDLALIRQRNMDIDQELDEIAAGVNVIKQIAIQMGDELDKQNEMLDNIETKVDKANEHVAAVNEKMKLALDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.41
4 0.42
5 0.43
6 0.38
7 0.35
8 0.41
9 0.45
10 0.45
11 0.47
12 0.46
13 0.44
14 0.46
15 0.45
16 0.38
17 0.38
18 0.34
19 0.37
20 0.41
21 0.4
22 0.37
23 0.36
24 0.41
25 0.41
26 0.49
27 0.46
28 0.46
29 0.52
30 0.57
31 0.58
32 0.53
33 0.49
34 0.46
35 0.5
36 0.52
37 0.53
38 0.52
39 0.51
40 0.54
41 0.52
42 0.47
43 0.43
44 0.43
45 0.38
46 0.41
47 0.42
48 0.43
49 0.5
50 0.55
51 0.55
52 0.52
53 0.53
54 0.55
55 0.61
56 0.61
57 0.57
58 0.53
59 0.51
60 0.51
61 0.47
62 0.39
63 0.3
64 0.26
65 0.21
66 0.18
67 0.19
68 0.15
69 0.15
70 0.15
71 0.15
72 0.14
73 0.15
74 0.21
75 0.21
76 0.26
77 0.33
78 0.42
79 0.51
80 0.58
81 0.67
82 0.72
83 0.76
84 0.79
85 0.8
86 0.8
87 0.79
88 0.76
89 0.71
90 0.7
91 0.66
92 0.66
93 0.67
94 0.59
95 0.53
96 0.51
97 0.53
98 0.48
99 0.54
100 0.53
101 0.49
102 0.5
103 0.51
104 0.51
105 0.46
106 0.45
107 0.37
108 0.29
109 0.26
110 0.28
111 0.26
112 0.22
113 0.2
114 0.17
115 0.17
116 0.19
117 0.17
118 0.13
119 0.14
120 0.14
121 0.19
122 0.2
123 0.21
124 0.17
125 0.18
126 0.18
127 0.16
128 0.15
129 0.1
130 0.08
131 0.07
132 0.06
133 0.05
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.02
140 0.03
141 0.03
142 0.03
143 0.05
144 0.05
145 0.06
146 0.07
147 0.07
148 0.09
149 0.09
150 0.09
151 0.1
152 0.1
153 0.1
154 0.1
155 0.1
156 0.08
157 0.08
158 0.09
159 0.07
160 0.07
161 0.1
162 0.12
163 0.13
164 0.14
165 0.16
166 0.16
167 0.17
168 0.17
169 0.14
170 0.12
171 0.1
172 0.1
173 0.08
174 0.09
175 0.09
176 0.09
177 0.1
178 0.1
179 0.12
180 0.13
181 0.15
182 0.14
183 0.15
184 0.16
185 0.15
186 0.15
187 0.13
188 0.11
189 0.08
190 0.07
191 0.05
192 0.04
193 0.03
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.05
200 0.07
201 0.07
202 0.07
203 0.07
204 0.08
205 0.09
206 0.11
207 0.11
208 0.11
209 0.1
210 0.1
211 0.11
212 0.12
213 0.11
214 0.12
215 0.13
216 0.14
217 0.14
218 0.17
219 0.16
220 0.15
221 0.21
222 0.21
223 0.19
224 0.22
225 0.28
226 0.26
227 0.28
228 0.29
229 0.25
230 0.27
231 0.29
232 0.29
233 0.22
234 0.21
235 0.2
236 0.18