Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I2U6

Protein Details
Accession A0A1Y2I2U6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-45VRVRVRQHAMKHPQRWRWHVTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 6, cyto 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040415  SETD9  
Amino Acid Sequences MGSHPIISVPACVAAQQLLLVAEHVRVRVRQHAMKHPQRWRWHVTNYLDRLYPLQALRLRLRQPNSKSLPGPPSTLSSYGKPTQWTPPSQPQLVSSLHSLLTALWHADHTSTLPRPLCLIRAGFHFVPRRAPSHMPYGGTGVFLHPTNASTDPDPESASPSVLPANQVISIYPGTIYSPTDPILFASIHNAYILRRLDGHLIDGNPRGLSRWIYQGLVRRYWWPGTRWPPCDPGDWLLDPEHKPEIDLRNPYAIGQFINHGTPDRPANVAYVEVEMPLDTLPLHLHQYLPNAPYRAWHGYPRLAGSKYDPAQVPEVCGGEDVVVPMVVLVTTREVKVGEELLSTYHEIVRQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.08
6 0.08
7 0.08
8 0.08
9 0.1
10 0.11
11 0.13
12 0.15
13 0.16
14 0.2
15 0.28
16 0.35
17 0.38
18 0.44
19 0.53
20 0.62
21 0.69
22 0.76
23 0.77
24 0.78
25 0.81
26 0.82
27 0.8
28 0.77
29 0.74
30 0.73
31 0.71
32 0.72
33 0.68
34 0.63
35 0.55
36 0.48
37 0.43
38 0.36
39 0.33
40 0.23
41 0.26
42 0.26
43 0.3
44 0.35
45 0.4
46 0.43
47 0.46
48 0.52
49 0.54
50 0.56
51 0.61
52 0.62
53 0.61
54 0.58
55 0.58
56 0.59
57 0.52
58 0.49
59 0.41
60 0.38
61 0.35
62 0.37
63 0.32
64 0.27
65 0.31
66 0.32
67 0.32
68 0.31
69 0.3
70 0.35
71 0.39
72 0.41
73 0.42
74 0.49
75 0.52
76 0.52
77 0.5
78 0.42
79 0.41
80 0.37
81 0.32
82 0.23
83 0.19
84 0.17
85 0.16
86 0.15
87 0.1
88 0.1
89 0.09
90 0.08
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.12
98 0.13
99 0.18
100 0.18
101 0.18
102 0.2
103 0.21
104 0.22
105 0.19
106 0.19
107 0.16
108 0.18
109 0.23
110 0.21
111 0.26
112 0.29
113 0.27
114 0.33
115 0.33
116 0.33
117 0.32
118 0.35
119 0.32
120 0.34
121 0.36
122 0.3
123 0.29
124 0.28
125 0.24
126 0.22
127 0.19
128 0.12
129 0.1
130 0.09
131 0.1
132 0.07
133 0.08
134 0.09
135 0.11
136 0.11
137 0.11
138 0.13
139 0.14
140 0.15
141 0.15
142 0.13
143 0.15
144 0.14
145 0.13
146 0.11
147 0.1
148 0.1
149 0.09
150 0.1
151 0.07
152 0.08
153 0.08
154 0.08
155 0.07
156 0.08
157 0.08
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.07
164 0.06
165 0.07
166 0.08
167 0.08
168 0.08
169 0.08
170 0.09
171 0.08
172 0.07
173 0.09
174 0.09
175 0.09
176 0.09
177 0.09
178 0.08
179 0.13
180 0.13
181 0.11
182 0.11
183 0.12
184 0.14
185 0.14
186 0.16
187 0.13
188 0.13
189 0.15
190 0.15
191 0.15
192 0.12
193 0.12
194 0.11
195 0.1
196 0.12
197 0.12
198 0.16
199 0.16
200 0.17
201 0.2
202 0.26
203 0.28
204 0.28
205 0.28
206 0.25
207 0.27
208 0.3
209 0.31
210 0.27
211 0.32
212 0.4
213 0.46
214 0.48
215 0.49
216 0.5
217 0.49
218 0.48
219 0.42
220 0.35
221 0.31
222 0.28
223 0.26
224 0.22
225 0.26
226 0.23
227 0.23
228 0.23
229 0.18
230 0.18
231 0.22
232 0.26
233 0.27
234 0.31
235 0.3
236 0.31
237 0.31
238 0.31
239 0.27
240 0.21
241 0.16
242 0.13
243 0.13
244 0.11
245 0.12
246 0.12
247 0.12
248 0.12
249 0.14
250 0.16
251 0.15
252 0.15
253 0.15
254 0.16
255 0.15
256 0.15
257 0.13
258 0.13
259 0.11
260 0.1
261 0.1
262 0.08
263 0.08
264 0.07
265 0.06
266 0.04
267 0.05
268 0.06
269 0.08
270 0.1
271 0.1
272 0.12
273 0.14
274 0.19
275 0.23
276 0.24
277 0.27
278 0.26
279 0.25
280 0.26
281 0.31
282 0.32
283 0.31
284 0.35
285 0.35
286 0.39
287 0.41
288 0.44
289 0.43
290 0.38
291 0.37
292 0.36
293 0.4
294 0.37
295 0.39
296 0.36
297 0.33
298 0.37
299 0.36
300 0.34
301 0.27
302 0.26
303 0.21
304 0.2
305 0.17
306 0.13
307 0.13
308 0.1
309 0.08
310 0.07
311 0.07
312 0.06
313 0.06
314 0.05
315 0.05
316 0.05
317 0.09
318 0.11
319 0.12
320 0.13
321 0.13
322 0.15
323 0.17
324 0.19
325 0.16
326 0.15
327 0.15
328 0.15
329 0.17
330 0.17
331 0.15
332 0.15