Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2H9H3

Protein Details
Accession A0A1Y2H9H3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
162-190TVVSRETYRKWLRKQRKTKQKAEFLVQASHydrophilic
NLS Segment(s)
PositionSequence
175-178KQRK
Subcellular Location(s) mito 19, nucl 5, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013875  Pam17  
Gene Ontology GO:0001405  C:PAM complex, Tim23 associated import motor  
GO:0030150  P:protein import into mitochondrial matrix  
Pfam View protein in Pfam  
PF08566  Pam17  
Amino Acid Sequences MHRHQSTLASPSSPKPTPASSSAARATPTPSQPAQPAVTWTEYLSLRKDMRLRNQIFSFVMSPMAFVGATFYVAATYQFDPTETIMGIESPWIVGIGAMTVGAIAATMTPVSLEALWRVVNPTKVKKLDALDREFYRRIQKHRAHASLAGPQLHLFDYYGATVVSRETYRKWLRKQRKTKQKAEFLVQASKIKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.35
4 0.37
5 0.38
6 0.4
7 0.34
8 0.39
9 0.38
10 0.36
11 0.33
12 0.29
13 0.3
14 0.3
15 0.31
16 0.31
17 0.29
18 0.3
19 0.31
20 0.35
21 0.33
22 0.27
23 0.27
24 0.24
25 0.25
26 0.22
27 0.2
28 0.2
29 0.19
30 0.2
31 0.2
32 0.23
33 0.22
34 0.26
35 0.32
36 0.34
37 0.42
38 0.5
39 0.51
40 0.52
41 0.52
42 0.51
43 0.45
44 0.41
45 0.32
46 0.23
47 0.21
48 0.14
49 0.13
50 0.1
51 0.1
52 0.08
53 0.06
54 0.07
55 0.05
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.09
68 0.09
69 0.1
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.05
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.03
99 0.03
100 0.03
101 0.04
102 0.05
103 0.06
104 0.06
105 0.08
106 0.1
107 0.15
108 0.19
109 0.24
110 0.3
111 0.32
112 0.33
113 0.35
114 0.37
115 0.4
116 0.43
117 0.43
118 0.41
119 0.42
120 0.45
121 0.43
122 0.41
123 0.43
124 0.41
125 0.42
126 0.47
127 0.51
128 0.57
129 0.65
130 0.66
131 0.59
132 0.57
133 0.54
134 0.5
135 0.47
136 0.38
137 0.29
138 0.26
139 0.24
140 0.2
141 0.18
142 0.12
143 0.09
144 0.09
145 0.09
146 0.09
147 0.08
148 0.07
149 0.07
150 0.07
151 0.09
152 0.1
153 0.12
154 0.14
155 0.24
156 0.34
157 0.43
158 0.52
159 0.61
160 0.71
161 0.8
162 0.89
163 0.9
164 0.91
165 0.93
166 0.93
167 0.92
168 0.91
169 0.87
170 0.84
171 0.8
172 0.74
173 0.72
174 0.65
175 0.6