Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2H8B0

Protein Details
Accession A0A1Y2H8B0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-27FPIQHQQPKIKQKHLRGRFIGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences AIRFQLFPIQHQQPKIKQKHLRGRFIGRLDPQLVLDNLYLTAPWIMSTCPSESVGMVQGQPKYASRMLRTVVCSRGRASGCGTGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.69
4 0.68
5 0.75
6 0.8
7 0.82
8 0.82
9 0.77
10 0.77
11 0.74
12 0.7
13 0.65
14 0.56
15 0.51
16 0.43
17 0.37
18 0.3
19 0.25
20 0.21
21 0.17
22 0.14
23 0.1
24 0.09
25 0.08
26 0.07
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.07
35 0.07
36 0.09
37 0.1
38 0.1
39 0.09
40 0.1
41 0.11
42 0.1
43 0.11
44 0.13
45 0.12
46 0.13
47 0.14
48 0.14
49 0.17
50 0.2
51 0.23
52 0.23
53 0.27
54 0.29
55 0.32
56 0.36
57 0.36
58 0.4
59 0.4
60 0.39
61 0.37
62 0.42
63 0.39
64 0.36
65 0.36