Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HB20

Protein Details
Accession A0A1Y2HB20   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-30VSLAVRMWRNPRKARKGRADQRMSIHydrophilic
NLS Segment(s)
PositionSequence
15-24NPRKARKGRA
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MWPCAVSLAVRMWRNPRKARKGRADQRMSIARVRQLARRVRCWMTTRRQAGIAVAAAAAADTIEVAVAAVAERPREAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.63
4 0.68
5 0.76
6 0.83
7 0.84
8 0.87
9 0.88
10 0.89
11 0.84
12 0.75
13 0.73
14 0.69
15 0.6
16 0.52
17 0.45
18 0.37
19 0.35
20 0.35
21 0.32
22 0.33
23 0.38
24 0.39
25 0.41
26 0.44
27 0.41
28 0.44
29 0.44
30 0.45
31 0.46
32 0.51
33 0.5
34 0.46
35 0.45
36 0.41
37 0.37
38 0.31
39 0.23
40 0.14
41 0.1
42 0.08
43 0.07
44 0.06
45 0.05
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.06
57 0.07
58 0.08