Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I0F7

Protein Details
Accession A0A1Y2I0F7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-117RSATRRRCIWRTTRRWRLWCRIQPTQRQRLWRRRCIRRWRPAARCRWRVRRLWRDGRRYNCFHydrophilic
NLS Segment(s)
PositionSequence
92-99RRWRPAAR
Subcellular Location(s) nucl 14, mito 8, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MAMFGAGAGFGAANQQQQQSAFSTFHPCSFHHRPPDPDPDLSPPPILCPSRLWSWRSATRRRCIWRTTRRWRLWCRIQPTQRQRLWRRRCIRRWRPAARCRWRVRRLWRDGRRYNCFWRCWRHGVWGSKHSTAAWWRIVWRWREQHGCDHRVWWGRFWWCWSGSDGRVWCKHAWRRHGRLICGPRAKPRHWRSEIHCDARN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.15
5 0.17
6 0.18
7 0.2
8 0.19
9 0.19
10 0.25
11 0.24
12 0.27
13 0.28
14 0.26
15 0.32
16 0.4
17 0.46
18 0.48
19 0.53
20 0.57
21 0.6
22 0.69
23 0.64
24 0.58
25 0.53
26 0.5
27 0.48
28 0.43
29 0.38
30 0.28
31 0.27
32 0.31
33 0.29
34 0.23
35 0.22
36 0.25
37 0.31
38 0.36
39 0.35
40 0.33
41 0.39
42 0.46
43 0.51
44 0.57
45 0.57
46 0.6
47 0.66
48 0.69
49 0.69
50 0.67
51 0.7
52 0.71
53 0.74
54 0.78
55 0.8
56 0.8
57 0.84
58 0.84
59 0.83
60 0.83
61 0.8
62 0.76
63 0.75
64 0.74
65 0.76
66 0.77
67 0.77
68 0.7
69 0.72
70 0.74
71 0.75
72 0.77
73 0.77
74 0.78
75 0.78
76 0.85
77 0.86
78 0.87
79 0.87
80 0.88
81 0.88
82 0.88
83 0.86
84 0.86
85 0.85
86 0.84
87 0.82
88 0.82
89 0.79
90 0.77
91 0.79
92 0.78
93 0.78
94 0.8
95 0.8
96 0.8
97 0.81
98 0.81
99 0.77
100 0.72
101 0.71
102 0.67
103 0.63
104 0.59
105 0.59
106 0.57
107 0.56
108 0.53
109 0.51
110 0.53
111 0.55
112 0.55
113 0.54
114 0.53
115 0.48
116 0.47
117 0.39
118 0.34
119 0.3
120 0.28
121 0.23
122 0.2
123 0.2
124 0.25
125 0.31
126 0.31
127 0.36
128 0.38
129 0.42
130 0.48
131 0.49
132 0.54
133 0.57
134 0.58
135 0.5
136 0.46
137 0.46
138 0.47
139 0.46
140 0.38
141 0.36
142 0.36
143 0.37
144 0.4
145 0.38
146 0.3
147 0.31
148 0.31
149 0.3
150 0.28
151 0.33
152 0.32
153 0.34
154 0.36
155 0.39
156 0.38
157 0.43
158 0.5
159 0.51
160 0.59
161 0.63
162 0.68
163 0.74
164 0.78
165 0.74
166 0.76
167 0.76
168 0.75
169 0.74
170 0.69
171 0.69
172 0.69
173 0.69
174 0.7
175 0.7
176 0.72
177 0.69
178 0.74
179 0.72
180 0.75
181 0.8