Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HJR1

Protein Details
Accession A0A1Y2HJR1    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
191-211MLMHRKHTKLSAKNQRKLTKAHydrophilic
NLS Segment(s)
PositionSequence
202-214AKNQRKLTKAVKR
Subcellular Location(s) mito 16.5, cyto_mito 10, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001648  Ribosomal_S18  
IPR036870  Ribosomal_S18_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01084  Ribosomal_S18  
Amino Acid Sequences MHSTGASRGLLPAAGAAAARRCLATDSVPHAPASAQPTTTPAGNGADLSNQAQDPTAAPARPASAPLLSELGALPTEPAPKRQFQYARWSGPSPYAPKKRQQVVPYVPPSQGGTLLASDRHLTVQGSNLHHRAGEMYTPADLDESQPKTFPPAVPSLNTIQFDVFKAMGTDPLASYKDVTLLSNFVTETGMLMHRKHTKLSAKNQRKLTKAVKRARAMGLMPHTYRMETQTEKNRGVGIADFLNLTPRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.11
6 0.11
7 0.11
8 0.11
9 0.13
10 0.15
11 0.16
12 0.19
13 0.24
14 0.29
15 0.3
16 0.29
17 0.27
18 0.26
19 0.26
20 0.26
21 0.22
22 0.18
23 0.17
24 0.2
25 0.21
26 0.21
27 0.18
28 0.14
29 0.14
30 0.14
31 0.14
32 0.12
33 0.12
34 0.12
35 0.13
36 0.13
37 0.11
38 0.11
39 0.1
40 0.1
41 0.1
42 0.14
43 0.16
44 0.14
45 0.15
46 0.15
47 0.18
48 0.17
49 0.18
50 0.15
51 0.12
52 0.13
53 0.14
54 0.14
55 0.12
56 0.12
57 0.1
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.13
64 0.13
65 0.18
66 0.21
67 0.25
68 0.26
69 0.34
70 0.37
71 0.35
72 0.45
73 0.47
74 0.49
75 0.48
76 0.48
77 0.41
78 0.4
79 0.41
80 0.36
81 0.38
82 0.43
83 0.43
84 0.49
85 0.56
86 0.59
87 0.6
88 0.58
89 0.58
90 0.55
91 0.6
92 0.58
93 0.52
94 0.45
95 0.4
96 0.37
97 0.28
98 0.22
99 0.14
100 0.09
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.06
110 0.06
111 0.11
112 0.15
113 0.17
114 0.19
115 0.2
116 0.2
117 0.19
118 0.19
119 0.15
120 0.11
121 0.09
122 0.08
123 0.08
124 0.07
125 0.08
126 0.08
127 0.07
128 0.06
129 0.07
130 0.12
131 0.15
132 0.15
133 0.15
134 0.15
135 0.18
136 0.2
137 0.2
138 0.17
139 0.19
140 0.21
141 0.21
142 0.24
143 0.24
144 0.25
145 0.25
146 0.22
147 0.18
148 0.17
149 0.17
150 0.16
151 0.13
152 0.09
153 0.09
154 0.09
155 0.1
156 0.1
157 0.1
158 0.08
159 0.11
160 0.12
161 0.11
162 0.12
163 0.1
164 0.12
165 0.12
166 0.13
167 0.11
168 0.11
169 0.11
170 0.11
171 0.11
172 0.09
173 0.09
174 0.08
175 0.07
176 0.08
177 0.11
178 0.12
179 0.12
180 0.19
181 0.26
182 0.27
183 0.29
184 0.35
185 0.41
186 0.48
187 0.58
188 0.64
189 0.67
190 0.73
191 0.81
192 0.8
193 0.75
194 0.75
195 0.74
196 0.73
197 0.73
198 0.75
199 0.75
200 0.72
201 0.73
202 0.68
203 0.62
204 0.53
205 0.5
206 0.47
207 0.44
208 0.4
209 0.39
210 0.36
211 0.33
212 0.33
213 0.29
214 0.28
215 0.26
216 0.34
217 0.4
218 0.46
219 0.47
220 0.47
221 0.45
222 0.4
223 0.37
224 0.31
225 0.24
226 0.18
227 0.17
228 0.17
229 0.15