Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HL43

Protein Details
Accession A0A1Y2HL43    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
56-89RARHNNRLIQQRQHKRNKTRKRSRDRTIHAHQPHBasic
NLS Segment(s)
PositionSequence
65-80QQRQHKRNKTRKRSRD
Subcellular Location(s) mito 16, nucl 5.5, cyto_nucl 4, pero 2, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MWSGQVLVYCTYLLIFRLTTELCTRWSTVPPGICLDVHKMVNKNGSVSKPASGHLRARHNNRLIQQRQHKRNKTRKRSRDRTIHAHQPHWGIHAKSITPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.11
5 0.11
6 0.13
7 0.16
8 0.16
9 0.17
10 0.19
11 0.21
12 0.2
13 0.22
14 0.24
15 0.25
16 0.26
17 0.24
18 0.25
19 0.24
20 0.22
21 0.21
22 0.21
23 0.21
24 0.2
25 0.21
26 0.21
27 0.22
28 0.25
29 0.24
30 0.22
31 0.22
32 0.21
33 0.21
34 0.2
35 0.21
36 0.17
37 0.18
38 0.2
39 0.2
40 0.23
41 0.26
42 0.34
43 0.38
44 0.44
45 0.51
46 0.51
47 0.53
48 0.54
49 0.58
50 0.54
51 0.57
52 0.62
53 0.64
54 0.7
55 0.77
56 0.81
57 0.81
58 0.88
59 0.9
60 0.91
61 0.92
62 0.92
63 0.93
64 0.93
65 0.92
66 0.92
67 0.89
68 0.88
69 0.84
70 0.84
71 0.78
72 0.71
73 0.65
74 0.59
75 0.52
76 0.46
77 0.44
78 0.35
79 0.34
80 0.36