Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HZX5

Protein Details
Accession A0A1Y2HZX5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-74GLSASPARSRRRRVGRRRGTBasic
NLS Segment(s)
PositionSequence
61-74ARSRRRRVGRRRGT
Subcellular Location(s) nucl 15, mito 5, cyto 4, plas 2
Family & Domain DBs
Amino Acid Sequences MDEEVEERNKAFEWTSYSWGKMQIIRYWSRCHAIVVLYTSKRRMWLLVCWLSAGGLSASPARSRRRRVGRRRGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.27
4 0.28
5 0.28
6 0.3
7 0.29
8 0.26
9 0.25
10 0.24
11 0.28
12 0.31
13 0.33
14 0.35
15 0.35
16 0.34
17 0.31
18 0.28
19 0.23
20 0.19
21 0.17
22 0.16
23 0.18
24 0.17
25 0.17
26 0.18
27 0.18
28 0.18
29 0.18
30 0.17
31 0.15
32 0.18
33 0.26
34 0.28
35 0.28
36 0.26
37 0.26
38 0.24
39 0.21
40 0.17
41 0.09
42 0.05
43 0.06
44 0.07
45 0.08
46 0.12
47 0.17
48 0.26
49 0.34
50 0.41
51 0.51
52 0.61
53 0.71
54 0.79