Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HY29

Protein Details
Accession A0A1Y2HY29    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
97-122PAERKIKTTRALKKAKHFPQRQFAVLHydrophilic
NLS Segment(s)
PositionSequence
84-113RAKKTRAIRRALTPAERKIKTTRALKKAKH
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MTKVKTFELRTKSKAELSKQLDDLRRELLSLRIKQQSGQSNQKPLEIRNVRRSIARVLTVINQQTKADVLKEYAGKKYIPIDLRAKKTRAIRRALTPAERKIKTTRALKKAKHFPQRQFAVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.55
4 0.54
5 0.56
6 0.55
7 0.58
8 0.57
9 0.52
10 0.49
11 0.42
12 0.36
13 0.3
14 0.27
15 0.27
16 0.29
17 0.3
18 0.34
19 0.36
20 0.36
21 0.38
22 0.43
23 0.44
24 0.44
25 0.5
26 0.49
27 0.51
28 0.51
29 0.53
30 0.48
31 0.41
32 0.44
33 0.42
34 0.43
35 0.46
36 0.48
37 0.45
38 0.45
39 0.46
40 0.39
41 0.34
42 0.3
43 0.2
44 0.18
45 0.2
46 0.21
47 0.22
48 0.19
49 0.16
50 0.15
51 0.15
52 0.14
53 0.12
54 0.1
55 0.08
56 0.08
57 0.1
58 0.14
59 0.15
60 0.17
61 0.18
62 0.17
63 0.17
64 0.19
65 0.22
66 0.2
67 0.24
68 0.31
69 0.36
70 0.44
71 0.49
72 0.48
73 0.48
74 0.55
75 0.59
76 0.58
77 0.58
78 0.54
79 0.56
80 0.63
81 0.63
82 0.63
83 0.6
84 0.61
85 0.64
86 0.6
87 0.57
88 0.54
89 0.55
90 0.55
91 0.58
92 0.6
93 0.6
94 0.69
95 0.73
96 0.78
97 0.82
98 0.84
99 0.85
100 0.84
101 0.82
102 0.83
103 0.82