Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2H453

Protein Details
Accession A0A1Y2H453   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-117HDTNCMPRKTKKSKGERENKQKKYEQTQGTHydrophilic
NLS Segment(s)
PositionSequence
95-109RKTKKSKGERENKQK
Subcellular Location(s) mito 13.5, cyto_mito 9, nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLNIILTHVIMFRLYKIDQHGDQRDAFDHDAQHSPAGGTWGAGQMMKHWSFWKERGARTIPPPQEQSVRQWTRNPQHVELGEACSRVHDTNCMPRKTKKSKGERENKQKKYEQTQGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.19
4 0.24
5 0.27
6 0.35
7 0.39
8 0.38
9 0.39
10 0.38
11 0.35
12 0.33
13 0.31
14 0.25
15 0.21
16 0.2
17 0.22
18 0.21
19 0.2
20 0.16
21 0.14
22 0.13
23 0.13
24 0.1
25 0.07
26 0.07
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.13
33 0.13
34 0.14
35 0.14
36 0.17
37 0.19
38 0.22
39 0.28
40 0.28
41 0.29
42 0.34
43 0.36
44 0.37
45 0.39
46 0.45
47 0.39
48 0.37
49 0.38
50 0.34
51 0.35
52 0.33
53 0.33
54 0.36
55 0.37
56 0.36
57 0.39
58 0.45
59 0.48
60 0.55
61 0.55
62 0.46
63 0.48
64 0.46
65 0.45
66 0.37
67 0.35
68 0.28
69 0.23
70 0.21
71 0.16
72 0.18
73 0.16
74 0.15
75 0.14
76 0.17
77 0.27
78 0.35
79 0.39
80 0.41
81 0.48
82 0.58
83 0.64
84 0.71
85 0.7
86 0.73
87 0.8
88 0.87
89 0.89
90 0.9
91 0.92
92 0.93
93 0.91
94 0.89
95 0.86
96 0.84
97 0.82