Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2I4L7

Protein Details
Accession A0A1Y2I4L7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-97VTVTPSAAGCRRRRRRRKKNVQGCGRHydrophilic
NLS Segment(s)
PositionSequence
82-90RRRRRRRKK
Subcellular Location(s) mito 21, extr 3, nucl 2
Family & Domain DBs
Amino Acid Sequences MIVLQWHMVLLWPKSWLWSVMLIRLMLTLKEQWTAGLAEWCVRRCTWGPARGVPGTITASGAKAGAWWYELVTVTPSAAGCRRRRRRRKKNVQGCGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.15
5 0.2
6 0.2
7 0.22
8 0.24
9 0.22
10 0.2
11 0.2
12 0.19
13 0.13
14 0.13
15 0.12
16 0.1
17 0.11
18 0.11
19 0.1
20 0.11
21 0.11
22 0.1
23 0.1
24 0.09
25 0.12
26 0.14
27 0.15
28 0.15
29 0.14
30 0.16
31 0.16
32 0.23
33 0.26
34 0.3
35 0.31
36 0.32
37 0.36
38 0.34
39 0.33
40 0.26
41 0.21
42 0.17
43 0.14
44 0.13
45 0.09
46 0.09
47 0.09
48 0.08
49 0.06
50 0.06
51 0.06
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.08
58 0.08
59 0.09
60 0.09
61 0.08
62 0.09
63 0.08
64 0.1
65 0.15
66 0.22
67 0.29
68 0.41
69 0.52
70 0.62
71 0.74
72 0.83
73 0.89
74 0.93
75 0.96
76 0.97
77 0.97