Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HMA7

Protein Details
Accession A0A1Y2HMA7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRPMARQWPHRQSGRRSREAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MRPMARQWPHRQSGRRSREAAVGMMIRRMIRLRNEQGGRMHRGAGRQVWRRSMWARRAPRLGTAGWCWRQCSMTATACAWRSVRRVGRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.72
4 0.66
5 0.64
6 0.57
7 0.48
8 0.4
9 0.33
10 0.26
11 0.24
12 0.23
13 0.16
14 0.16
15 0.16
16 0.16
17 0.18
18 0.26
19 0.29
20 0.36
21 0.37
22 0.4
23 0.44
24 0.45
25 0.45
26 0.38
27 0.36
28 0.28
29 0.29
30 0.27
31 0.26
32 0.29
33 0.32
34 0.34
35 0.35
36 0.35
37 0.37
38 0.4
39 0.43
40 0.44
41 0.46
42 0.5
43 0.52
44 0.56
45 0.54
46 0.52
47 0.47
48 0.4
49 0.34
50 0.32
51 0.34
52 0.35
53 0.35
54 0.33
55 0.32
56 0.32
57 0.3
58 0.29
59 0.26
60 0.25
61 0.26
62 0.26
63 0.3
64 0.3
65 0.32
66 0.3
67 0.28
68 0.28
69 0.35
70 0.4